(data stored in SCRATCH zone)

EMBL: CP002293.PE327

CP002293.PE327       Location/Qualifiers
FT   CDS_pept        377608..378051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0338"
FT                   /product="protein of unknown function DUF180"
FT                   /note="PFAM: protein of unknown function DUF180; KEGG:
FT                   lsp:Bsph_1154 flagellar assembly factor FliW"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73183"
FT                   /db_xref="GOA:A0A0F6BID2"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID2"
FT                   /inference="protein motif:PFAM:PF02623"
FT                   /protein_id="ADP73183.1"
FT                   /translation="MKITSKFLGEIEINEKQIIHFPNGIPGFEEEKQFVILPLEEQSPF
FT                   AILQSIHHSHVGFVIAYPFSFYPDYAFDLTEEDIEKLKLNSPDDCLTYTIMTLKEPFAD
FT                   STINLKAPIVINVKEKIGKQLILHDSVYPIRFPLSEARGKEGK"
     atgaaaataa catcaaaatt tttaggagaa atcgaaataa atgaaaaaca aattatccat        60
     tttcccaacg ggatccctgg atttgaagaa gaaaaacaat ttgtcatttt gccattagaa       120
     gaacaatcgc cgtttgcgat tttgcagtcg attcatcaca gccatgtcgg ctttgtcatt       180
     gcttatccat tctctttcta cccggattat gcgtttgatt taacagaaga agatattgaa       240
     aagctgaaat tgaattctcc tgatgattgc ttgacatata cgattatgac gctaaaagag       300
     ccgtttgctg attctaccat taacttaaaa gctccaatcg ttattaacgt gaaagaaaaa       360
     ataggaaagc aactcattct tcatgacagc gtctacccga tccgttttcc gttgtccgag       420
     gcgcgcggga aggagggaaa ataa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page