(data stored in ACNUC7421 zone)

EMBL: CP002293.PE329

CP002293.PE329       Location/Qualifiers
FT   CDS_pept        378402..379214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0340"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: lsp:Bsph_1156
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73185"
FT                   /db_xref="GOA:A0A0F6BID4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID4"
FT                   /inference="protein motif:PFAM:PF00669"
FT                   /protein_id="ADP73185.1"
FT                   /translation="MRIQHNISALNTYRQLSFNNTQAAKNLEKLSSGYRINRAGDDAAG
FT                   LAISEKMRGQIRGLEMASKNAQDGISLIQTAEGALNETHAILQRMRELAVQAANDTNVT
FT                   ADRKAIQDEINALVSEINRIAANTEFNTQKLLDGTFSGKAFQIGANSGQSITLTIATMN
FT                   ATALGVNALKVTNAASANNAITKINNAIEKVSTERSKLGAVQNRLEHTINNLGATAENL
FT                   TAAESRIRDVDMAKEMMEFTKNNILMQAAQAMLAQSNQMPQGVLQLLR"
     atgagaatcc aacacaacat ctctgcgtta aacacgtacc gccaattatc atttaacaac        60
     actcaagctg cgaaaaacct tgaaaaactt tcttcagggt accgcatcaa ccgtgctggc       120
     gacgatgcag caggccttgc catctctgaa aaaatgcgcg gccaaatccg cggtctagaa       180
     atggcatcga aaaacgcgca agacggtatc tctttaatcc aaacagctga aggtgcatta       240
     aacgaaacac atgcgatcct tcaacgtatg cgcgagcttg ccgtacaagc agcgaacgat       300
     acaaacgtaa cagctgaccg taaagcaatc caagacgaaa ttaatgcgct tgtgtctgaa       360
     attaaccgca tcgcggcaaa cactgaattt aacacgcaaa aacttttaga tggcactttc       420
     tctggtaaag cgtttcaaat tggagcgaac agtggtcaat ccattacatt aacaattgca       480
     actatgaacg caactgcact tggagtaaat gccttaaaag taacaaatgc agcaagcgca       540
     aataatgcga ttactaaaat taataatgca attgaaaaag tgtcgacaga acgttctaaa       600
     cttggtgctg ttcaaaaccg cctagaacac accatcaaca accttggcgc aactgcagaa       660
     aacttaactg ctgctgaatc acgtatccgt gatgttgata tggcgaaaga aatgatggaa       720
     ttcactaaaa ataatatctt aatgcaagcg gcgcaagcta tgttggctca atccaatcaa       780
     atgccgcagg gagtgttgca actacttcgg taa                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page