(data stored in ACNUC7421 zone)

EMBL: CP002293.PE332

CP002293.PE332       Location/Qualifiers
FT   CDS_pept        381209..382993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0343"
FT                   /product="protein of unknown function DUF115"
FT                   /note="PFAM: protein of unknown function DUF115; KEGG:
FT                   lsp:Bsph_1157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73188"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID7"
FT                   /inference="protein motif:PFAM:PF01973"
FT                   /protein_id="ADP73188.1"
FT                   /translation="MDNELKEYEIVEETAKSGHRIYKVNNYYLHSKYDPIREAAKFAER
FT                   HYKKNHLHILFGVGSGYIAKALSEKMTEEEFLIIVEPIEFLADKHLEEESQLERCIIIK
FT                   GEDQELFEKIYEPFGNTFGKRVSVVCSPNYDKICSSYYHSILKIVKDHIYMQQVNINTI
FT                   KYFSKEWQKNFTLNLFYAYDDVPLKCLEHIYNVPVVVASGGPSLTKQIPLLKKVRNHIL
FT                   LISSGSTINTLLKHDIEPDFIVTIDGGINNYRHFETIELKQARIIYSLSNHEKIRERFN
FT                   RRSLVFISNIDDDLKIYAQKLLNKEIDGILGGASVANFALNIAYMISTGPVALIGQDLA
FT                   YTDNKTHAEHNKNFRKIDETYIKQRGLFYTEGYYGGQVLTDYTFFTMKHNFERLLQTFS
FT                   QPERIYNCTEGGVKLEGYQQLSFQEFCDRYVDTNKNVPMFDIDSYPHRDIQEWEEFLIR
FT                   IENEIRLHDKVQRLAEEAVLLLKRNVSDTAFDAKILKKLDKIDEQLKPIFDEGMMSLIA
FT                   QPIVLDTFNNYLEKENETEQEMYQRVYARSMDLYSRLQEAAIDSKSYFMQLKEKIKNKI
FT                   ISMDKREKDDESHLRNTR"
     atggacaatg aactgaaaga gtacgaaatc gttgaggaaa ctgcgaaaag tggacatcgt        60
     atttataaag taaacaatta ttaccttcac agcaagtatg atccgattcg agaggctgca       120
     aaatttgccg aacgccatta taaaaagaac catcttcata ttttatttgg cgtgggttca       180
     ggatatattg cgaaagcttt aagtgaaaag atgactgagg aggaattttt aattattgtc       240
     gagcctatcg aatttttagc tgataaacat ctggaagaag aaagtcaatt agagcgatgc       300
     atcatcatta aaggagaaga tcaagagctt tttgaaaaaa tttatgaacc ttttggaaat       360
     acattcggta aaagagtttc tgttgtttgt tctcctaatt acgataaaat ttgttcaagc       420
     tattatcata gtatattaaa aatagtcaaa gatcatattt atatgcagca agtaaatata       480
     aatacaatta aatatttttc aaaagaatgg caaaagaact tcacattaaa tttattttat       540
     gcatatgatg atgtgccttt aaaatgtttg gaacatattt ataatgtgcc agttgtcgtt       600
     gcttccggtg gtccgtcgct aacaaagcaa atccctttat taaaaaaggt aaggaatcat       660
     attttgctaa tttcttctgg gtcgacgatt aacacacttc ttaaacatga tattgagcct       720
     gactttattg ttacgattga tgggggaatc aacaactata ggcattttga aacaatagag       780
     ctaaaacaag caagaataat ctattcatta tctaaccatg agaaaattag agaaagattc       840
     aatcgaagat cgcttgtatt tatatctaac atagatgatg atttaaaaat atatgcacaa       900
     aaattattaa ataaagaaat agatggtata ttagggggcg cttctgtcgc caatttcgca       960
     ttaaatatag cttatatgat ttcaacgggg cctgttgcat taattggtca agatttggcc      1020
     tataccgata acaaaacaca tgcagaacat aataaaaatt tcagaaaaat tgatgaaaca      1080
     tatattaaac aaagaggact gttctataca gaggggtatt atggtggtca agtattgaca      1140
     gattacacgt tttttacaat gaagcataat tttgaaagac tacttcaaac tttttcacag      1200
     cctgaaagaa tttacaattg tacagaaggc ggagttaagc tggagggcta tcaacaactt      1260
     tctttccaag agttttgcga cagatatgta gatacgaata aaaatgtacc aatgtttgat      1320
     atcgattcat atccgcacag agatattcaa gaatgggaag agtttttaat ccgaattgaa      1380
     aatgaaataa gattacatga taaagtacag cgccttgctg aggaagcagt gctgttgctg      1440
     aaaagaaatg tttctgatac agcgtttgat gcaaaaattt taaaaaagtt agataaaatt      1500
     gatgaacagt taaaaccaat ttttgatgaa ggaatgatgt cattaattgc ccaacctatt      1560
     gttttagata catttaataa ctacctggaa aaagagaatg aaacggaaca agaaatgtat      1620
     caacgagtat acgctcgttc catggattta tattcgcgtt tgcaagaagc tgcaatcgat      1680
     tcaaaatctt atttcatgca gttaaaagaa aaaattaaaa ataaaattat ttcgatggat      1740
     aagagggaga aagatgatga atctcattta cgaaacacaa gatag                      1785
//

If you have problems or comments...

PBIL Back to PBIL home page