(data stored in ACNUC7421 zone)

EMBL: CP002293.PE333

CP002293.PE333       Location/Qualifiers
FT   CDS_pept        382962..383324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0344"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsp:Bsph_1158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73189"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID8"
FT                   /inference="similar to AA sequence:KEGG:Bsph_1158"
FT                   /protein_id="ADP73189.1"
FT                   /translation="MMNLIYETQDSFYQYIERVASGTQTIADYLREDKVGEAMQLIAQF
FT                   SEGVAWLTKVIVLMREHKYHINIDPSQINEFLLEINDGLERQDYVIVADMFEYEIKPFF
FT                   EEATKERFYQMKEDKN"
     atgatgaatc tcatttacga aacacaagat agtttctatc aatatattga gcgagtagca        60
     tcgggaacac aaacaatcgc tgactatttg cgtgaagata aagttgggga agcaatgcag       120
     ctaattgcgc aatttagcga aggcgttgct tggctaacga aggtaattgt attaatgcgg       180
     gaacataagt atcatattaa cattgatccg agccaaatta acgaattttt gctggaaatc       240
     aacgatggtt tagaacggca agattatgtt attgtcgccg atatgtttga atatgaaata       300
     aagccttttt ttgaagaggc aacgaaagaa agattttatc aaatgaagga agataaaaat       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page