(data stored in SCRATCH zone)

EMBL: CP002293.PE337

CP002293.PE337       Location/Qualifiers
FT   CDS_pept        387040..387588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0349"
FT                   /product="putative acetyltransferase"
FT                   /note="KEGG: pab:PAB0773 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73193"
FT                   /db_xref="GOA:A0A0F6BIE2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIE2"
FT                   /inference="similar to AA sequence:KEGG:PAB0773"
FT                   /protein_id="ADP73193.1"
FT                   /translation="MKPKDVYIHNSAEVSSKASVGKGTKIWNGVQIREGAIIGENCNIG
FT                   KDVYIDKNVIIGNCVKIQNGVSIYDGVEIEDYVFLGPHMTFTNDLYPRSFNTEWRKIPT
FT                   KVRYGASIGANATVVCGVTIGKYAMVGAGAVVTQDVPDHALAVGNPAKVIGYVCKCGQP
FT                   IHYGECCKKCGEVFTGGNE"
     atgaaaccaa aagatgttta tattcataat tctgccgaag tatctagtaa ggcttcggtt        60
     ggtaaaggaa ctaaaatatg gaatggggtt caaattagag aaggagcgat aataggagag       120
     aattgtaata ttggaaaaga tgtgtatatt gataaaaatg taatcatagg aaattgtgta       180
     aaaatccaaa atggggtttc catttatgat ggggttgaaa ttgaagacta tgtattttta       240
     ggaccacaca tgacatttac aaatgattta tatcctaggt catttaatac agaatggaga       300
     aagattccta ctaaagttcg ctatggtgcc tccattggag caaatgcaac tgttgtttgt       360
     ggggtgacga taggaaagta tgcaatggta ggtgcaggtg ctgtggttac acaggatgtt       420
     cctgaccatg ctttggctgt ggggaatcct gcgaaggtta ttggctatgt ttgtaaatgt       480
     ggtcaaccaa ttcattatgg agaatgttgt aaaaagtgtg gtgaagtttt cacaggggga       540
     aatgagtaa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page