(data stored in ACNUC7421 zone)

EMBL: CP002293.PE340

CP002293.PE340       Location/Qualifiers
FT   CDS_pept        390167..391279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0352"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="KEGG: tth:TTC0284 pleiotropic regulatory protein;
FT                   PFAM: DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73196"
FT                   /db_xref="GOA:A0A0F6BIE5"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIE5"
FT                   /inference="protein motif:PRIAM:2.6.1.50"
FT                   /protein_id="ADP73196.1"
FT                   /translation="MPELIPVFDLKSEINIIYDEVLESIQEVLKSGQFIMGEQVAAFEK
FT                   EVADYLGVRHAIGVNSGTDALVIGLRSVGIGKGDEVITTPFTFFATVEAIHQIGAVPKF
FT                   VDIENCTFNIDSRKIEEAITSKTKAILPVHLFGHAAEMRTIMDLAKAYDLKVVEDTAQA
FT                   FGGEYHGQKLGTIGDVGCFSFFPTKNLGAYGDGGLIVTNDDNVAEIARKLRVHGGKNKY
FT                   NNEMFGYNSRLDEIQAAILRIKLRYVQSWNEKRRKVAKIYSERLKEISNLVLPMEKGGI
FT                   KHVYHQYTVRIVNGNRDNIYEQLLARHVQTMIYYPLPVHHLPVYRAQNIDLNLPVAESI
FT                   SKQVLSLPIWPHIEDKQVEYVCNTLQSLLS"
     atgccggaat tgattcctgt ttttgatctt aaatctgaaa taaatatcat ttatgatgaa        60
     gtgctagaaa gtattcaaga agtattaaag tctggtcaat ttattatggg agaacaagta       120
     gcagcatttg aaaaagaagt agcagattat ctaggagttc ggcacgcaat aggagtaaac       180
     tctggtacag atgcgttagt cattggttta agatcagtag gaattggaaa aggggatgaa       240
     gtaattacaa ctccttttac attttttgct actgtagaag ctattcatca aattggtgct       300
     gtaccaaaat ttgttgatat tgaaaattgt acctttaata tcgattctcg aaaaatagaa       360
     gaagctatta catcaaaaac gaaggctatt ttacctgtcc atttgtttgg acatgctgct       420
     gagatgagaa ccattatgga tttagctaag gcatacgatt taaaagtggt agaggataca       480
     gctcaggctt ttggtggaga atatcatggc caaaagttag gtacaatcgg tgatgttgga       540
     tgtttttcat tttttccaac taaaaactta ggagcttacg gtgatggggg attgattgta       600
     actaacgatg acaatgtagc agaaatagct agaaagctac gagtacatgg cgggaaaaac       660
     aaatataata atgaaatgtt tggttataat tcccgattag atgaaattca agctgcaatt       720
     ttacgaatta aacttcgata tgttcaatct tggaatgaaa aaaggagaaa ggtagcaaaa       780
     atttattcag agagattaaa ggaaatatct aatcttgttt tacctatgga aaaaggtggt       840
     atcaaacatg tttatcatca atatactgtt agaattgtaa atggaaacag agataatatt       900
     tacgaacaat tattagctag acatgttcag accatgatat actatccttt acctgttcat       960
     catttacctg tttatcgtgc tcaaaatatt gacttaaatc tgccagttgc tgaatctatc      1020
     tcaaaacagg tgttaagttt accaatatgg ccgcacattg aagacaaaca agttgagtat      1080
     gtttgtaaca ctttacaatc gttgttgtct taa                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page