(data stored in SCRATCH zone)

EMBL: CP002293.PE341

CP002293.PE341       Location/Qualifiers
FT   CDS_pept        391312..391989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0353"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: gyc:GYMC61_3213 haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73197"
FT                   /db_xref="GOA:A0A0F6BIE6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIE6"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ADP73197.1"
FT                   /translation="MRYQGFIFDMDDTLYCEYDYVYSGFKVVSKLIAQSQKKITDNIVY
FT                   QYLIDEWKRNGRGKVFNKVCEKLGIDIDISYLVEAYRYHKPTIQMYDDAKKLLLYLKHK
FT                   KVQTGLITDGHPVAQYNKIKSLGLKKWIDCIIITGILGEEYYKPSEVPYKIALNSLGLE
FT                   AKQCVYIGDNPYKDFITAKKLGIKTIRVIRPIGDYMHVKLSSEFEADIVVYSLTDIMKM
FT                   NII"
     atgcggtatc aagggtttat ttttgatatg gacgatactt tatattgcga gtatgactat        60
     gtgtattctg gttttaaagt agtgtcaaaa ttaattgcac aatcccagaa aaaaattaca       120
     gataatatcg tttatcaata tttaatagat gaatggaaaa gaaatggacg cgggaaggtt       180
     tttaataagg tttgtgaaaa gttaggaata gacatagata tttcttattt agttgaagct       240
     taccgttatc ataaaccaac tattcaaatg tatgatgatg cgaaaaagtt gttattgtat       300
     ctaaagcata aaaaagtaca aacaggttta ataacagatg ggcatcctgt tgctcaatat       360
     aataaaataa aatcattagg tttaaaaaaa tggattgatt gtattatcat tactggaata       420
     ttgggtgaag aatattataa gcctagtgaa gttccatata aaattgcttt aaattcatta       480
     ggattagaag cgaaacagtg cgtttatatt ggagataatc cttataagga ttttattact       540
     gctaagaaat taggaataaa aacaattcgt gttattcgcc caataggaga ttatatgcac       600
     gtgaaattgt caagtgagtt tgaagcagat atcgtagttt attctttaac agatataatg       660
     aaaatgaata ttatctag                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page