(data stored in ACNUC7421 zone)

EMBL: CP002293.PE344

CP002293.PE344       Location/Qualifiers
FT   CDS_pept        393748..394788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0356"
FT                   /product="pseudaminic acid biosynthesis-associated protein
FT                   PseG"
FT                   /note="TIGRFAM: pseudaminic acid biosynthesis-associated
FT                   protein PseG; KEGG: gyc:GYMC61_3209 pseudaminic acid
FT                   biosynthesis-associated protein PseG"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73200"
FT                   /db_xref="InterPro:IPR020023"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIE9"
FT                   /inference="protein motif:TFAM:TIGR03590"
FT                   /protein_id="ADP73200.1"
FT                   /translation="MNILIRTDASMQIGTGHVMRCLTVAHEMRKRGHQTTFAMRNLQGH
FT                   LAAVVEKQGFHVEMLQYEGDFQFEKDVMEVQQLFLRQDYDICVIDHYRIDEKWEKMIRP
FT                   FVKKLIVIDDLANRSHDCDILLDPNVVNNYEHRYDHFVPKHCKKLLGPKYLILREEFTK
FT                   IREKIRPREGVVRNLLIFMGGSDPTGETLKVMKAFESFDGSFHHVDVVVGQANPDKEVV
FT                   RTYCEKFGFAYHCQIDYLASLMAKADFSIGAGGSTMWERCYVGLPSSSTIVADNQIETT
FT                   KMAAQLGVVINLGWHEEVTSKAYEKLLYQIIEQKENIQKMSIKGLQLTENPDGPNPWVT
FT                   PMLEMW"
     atgaatattt taatacgaac agatgcgtct atgcaaatag gtacaggtca tgtgatgaga        60
     tgtttgacgg ttgcccatga aatgcgaaag cgtggtcatc aaactacttt tgccatgaga       120
     aaccttcaag gccacttagc agccgttgtt gaaaaacaag gttttcacgt tgaaatgttg       180
     cagtacgaag gtgattttca attcgagaaa gatgtaatgg aagttcaaca attgtttttg       240
     aggcaagatt acgatatttg tgtcattgat cactatagga ttgatgaaaa atgggaaaaa       300
     atgattcgtc cttttgttaa aaaactgatt gtcattgatg atttagcaaa ccgctctcat       360
     gattgcgaca tattacttga cccaaatgtc gtaaataatt atgaacatcg gtacgatcac       420
     ttcgtcccga agcattgtaa aaaactgctc ggacctaaat atttaatttt acgagaagag       480
     tttacaaaaa ttcgtgaaaa aatacgccct agagaagggg ttgtacggaa tttgcttatt       540
     tttatggggg gaagcgaccc gactggagaa acgttaaaag tgatgaaagc tttcgaaagc       600
     tttgatggtt ctttccatca tgtggatgtc gttgtggggc aagcgaatcc cgataaagaa       660
     gttgtgcgta catattgtga aaagttcggt tttgcgtatc attgtcaaat cgattatttg       720
     gcatcattga tggcgaaagc ggatttttcc attggagctg gcggcagtac tatgtgggaa       780
     cgatgttatg tcgggttgcc ttcttcaagc acgattgttg cggataacca aattgaaaca       840
     acgaaaatgg ctgcacagct tggagtcgtt attaatctcg gctggcatga agaagtaaca       900
     agcaaagcat acgaaaaact gctctaccag ataattgaac aaaaagaaaa catccaaaaa       960
     atgagtataa aaggtttgca gttgacagaa aatcctgatg gaccgaatcc atgggtgact      1020
     ccaatgttag aaatgtggtg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page