(data stored in ACNUC7421 zone)

EMBL: CP002293.PE345

CP002293.PE345       Location/Qualifiers
FT   CDS_pept        394793..395839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0357"
FT                   /product="pseudaminic acid synthase"
FT                   /EC_number="2.5.1.56"
FT                   /note="SMART: SAF domain protein; TIGRFAM: pseudaminic acid
FT                   synthase; KEGG: gyc:GYMC61_3208 pseudaminic acid synthase;
FT                   PFAM: N-acetylneuraminic acid synthase domain; SAF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73201"
FT                   /db_xref="GOA:A0A0F6BIF0"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020030"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF0"
FT                   /inference="protein motif:TFAM:TIGR03586"
FT                   /protein_id="ADP73201.1"
FT                   /translation="MIQIGNRKIGKSEKPFIIAEMSGNHNQSLERALKIVDLAAEAGVD
FT                   AVKLQTYTPDTMTLDIHTGEFFIKSETNLWKGQSLYNLYKEAYTPWEWHEAIFERCKKH
FT                   GLLAFSSPFDETAVDFLETLNVPAYKIASFENIDIPLIKKVAATGKPVIISAGMATVAE
FT                   LYEAVQAVRSEGNDQIILLKCTSTYPATPENSNLATIPHMRELFGVEVGLSDHTMGIGT
FT                   AVAAVALGATVIEKHFTTSRAEGGVDAAFSLEPHEMKMLVEETERAWLSLGMIHYGPTN
FT                   AEKPSLEHRRSLYVTEDLKAGDIITKENVRAIRPGRGLPPKYYDLVLGKAVKKDVKKGT
FT                   PLSWDILL"
     atgattcaaa taggcaatag aaaaattgga aaaagcgaaa aacctttcat cattgcggaa        60
     atgtcaggca accataatca atctttagaa agggcgttaa aaattgtcga tcttgcagcg       120
     gaagcaggtg tcgatgcggt aaaattgcaa acatacactc ctgatacgat gactttagat       180
     attcatacag gtgaattttt cattaaaagt gagacgaatc tttggaaagg tcaatcatta       240
     tataacttgt ataaagaagc gtatactccg tgggaatggc atgaggcgat ctttgagcgt       300
     tgtaaaaagc atggattgct ggctttcagc tctccctttg atgaaacagc agtggatttt       360
     ttagaaacat taaatgtgcc ggcttataaa attgcttcgt ttgaaaatat agatatcccg       420
     ttaattaaaa aagtggctgc tacagggaaa ccggtcatta tttcggctgg aatggctact       480
     gttgcagaac tgtatgaggc agttcaagct gttcgttccg aaggaaatga tcaaattata       540
     ttgttgaaat gtacaagtac atatccagca acgccagaaa actcaaatct tgcaacgatt       600
     cctcatatgc gggaattgtt tggagttgaa gttggattgt ctgatcatac gatggggatt       660
     ggcactgcgg tagcagctgt agcgcttgga gcaacagtaa tcgaaaaaca tttcaccact       720
     tcccgtgcag aaggcggagt ggatgccgca ttttcactag agcctcatga aatgaaaatg       780
     cttgtcgaag aaacagaacg ggcttggctc agcctaggta tgatccatta cggtcctacc       840
     aatgcggaaa agccttccct tgaacatcga cgttctcttt atgttacaga ggatttaaag       900
     gcaggggata tcattacaaa agagaatgtt cgcgcgattc ggcctggacg tggattgccg       960
     ccaaaatatt atgatttagt tcttggaaaa gcagtgaaga aagatgtaaa aaaaggaaca      1020
     ccattaagct gggatatatt gttgtaa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page