(data stored in ACNUC7421 zone)

EMBL: CP002293.PE346

CP002293.PE346       Location/Qualifiers
FT   CDS_pept        395854..396999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0358"
FT                   /product="UDP-4-keto-6-deoxy-N-acetylglucosamine
FT                   4-aminotransferase"
FT                   /EC_number="2.6.1.50"
FT                   /note="TIGRFAM: UDP-4-keto-6-deoxy-N-acetylglucosamine
FT                   4-aminotransferase; KEGG: gyc:GYMC61_3206
FT                   UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase;
FT                   PFAM: DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73202"
FT                   /db_xref="GOA:A0A0F6BIF1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF1"
FT                   /inference="protein motif:TFAM:TIGR03588"
FT                   /protein_id="ADP73202.1"
FT                   /translation="MKKRESFLSYGQQWITDEDIEAVVTVLKSPFLTQGPKIHEFERKV
FT                   ADYVGAKYAVAFSNGTAALHGACFAAGIGEGDEVITTPITFAATSNAVLYCGGKPVFAD
FT                   IDDRTYNIDPKEIRKHITPNTKAIIPVDFTGQPADMDAIMEIANEHGLVVIEDGAHSLG
FT                   AEYKGRKVGMLAHMTMFSFHPVKPVTTAEGGVIVTDSEEYYEKLKRFRSHGIIKHNLSR
FT                   DEGPWYYEMVDLGYNYRMTDLQAALGISQMDKLDCFIERRREIANMYNEAFKTMDSVIV
FT                   PMQLERTQSGWHLYVLQLKLDKLKRSRREIFESLRAENIGVHVHYIPVYWHPYYQKLGY
FT                   RKGICPKAEQWYEQALTLPIFPKMTDEDVNDVIEAVKRNVY"
     atgaaaaaaa gggaatcttt cctttcctat ggacaacaat ggattacgga tgaagatatc        60
     gaagcagtcg taactgtgtt aaagtcgcct tttttaaccc aaggaccaaa aatccacgag       120
     tttgaacgaa aagtcgctga ttatgttgga gcgaagtatg ctgttgcgtt ttcaaacgga       180
     acggcagctc ttcacggcgc ttgttttgcc gcgggtatcg gtgaaggtga tgaagtgata       240
     acgacgccga ttacatttgc ggctacttcc aacgctgttc tttattgcgg gggaaaacct       300
     gtatttgcag atattgatga tcggacgtac aacattgatc cgaaagaaat acgcaagcat       360
     attactccaa atacaaaagc gattatccca gttgatttta ccgggcaacc agctgacatg       420
     gatgcaataa tggagatcgc taacgagcat ggtttggttg tcatcgaaga tggggcgcat       480
     tctctcgggg ctgagtataa agggcgaaaa gtcggcatgt tagcgcatat gacgatgttt       540
     agctttcatc ctgtcaagcc ggttacaaca gcagaaggag gagtcattgt aactgattca       600
     gaggagtatt atgaaaaact aaaacggttt cgctcgcacg gcattataaa gcataatttg       660
     tcacgggatg aaggcccttg gtattatgaa atggtagatt tagggtataa ctatcgaatg       720
     actgatcttc aagcggcgtt aggcatttca caaatggaca aattggattg ttttatcgaa       780
     agacgccgag aaattgcaaa tatgtataat gaagcgttta aaacgatgga ttctgttatt       840
     gtgccaatgc agcttgaaag aactcaatcg ggctggcatc tgtatgtgct tcaattaaaa       900
     ttggataaac taaaacgcag ccgcagagaa atttttgaga gtcttcgcgc agaaaacatt       960
     ggtgttcatg tgcattacat tccggtttat tggcatcctt attaccaaaa gttgggatat      1020
     agaaaaggaa tttgcccaaa agcggaacaa tggtatgaac aagcattaac attgccgatt      1080
     tttcctaaaa tgacggatga agatgtgaat gatgtgattg aagcggtgaa gaggaatgta      1140
     tattaa                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page