(data stored in ACNUC7421 zone)

EMBL: CP002293.PE348

CP002293.PE348       Location/Qualifiers
FT   CDS_pept        complement(398577..399386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0360"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: chy:CHY_0981
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73204"
FT                   /db_xref="GOA:A0A0F6BIF3"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF3"
FT                   /inference="protein motif:PFAM:PF00669"
FT                   /protein_id="ADP73204.1"
FT                   /translation="MKIQNQSMIAFSTYRYQRNVTNLTKTLEKLSSGLKIYRASDDAAG
FT                   LSISETLRAQIRGLAQSQRNMQDGLSVLKAAEEGLMNVNHLLQRIRELAVQNANDTLDA
FT                   KDRAASQKELDQLLQAIDDTAEKLEFNTKKILGENIPLTLQVGANPGQTITVDMVDTST
FT                   TSLGLNGATLLTRTDAEQLITKVDNALKKVTNDLTNVGADYEAIEHHLNNTMLKEANLT
FT                   TSESMLRDANIAREMMNYISGKIRQQGDYLLISHINRNVEETLKLLT"
     atgaaaatac aaaaccagtc aatgattgct ttttcgacct accgctatca gcgaaatgtc        60
     actaatctga ccaaaacact ggagaaactc tcttcaggtt taaaaattta tcgggcgagt       120
     gacgatgctg caggattaag catttcagaa acattgcggg cgcaaataag aggtttggcg       180
     caatcgcagc gaaatatgca agacggcctt tccgttttaa aagcagccga agaagggtta       240
     atgaacgtca atcacctcct gcaacggatt cgggagttag ctgtacaaaa tgccaatgat       300
     acactcgacg caaaagaccg cgcagccagt caaaaagaat tggatcagct gctgcaagcg       360
     attgatgata ctgctgaaaa gcttgagttt aatacaaaga aaattcttgg cgaaaacata       420
     ccgctaacat tacaagtcgg cgcaaatccc ggccaaacca ttaccgttga catggttgat       480
     acaagcacga ccagccttgg acttaacgga gcaacgctat taacgcgaac agatgctgaa       540
     cagcttataa caaaagtgga caatgcgctt aaaaaagtaa caaatgactt aacaaatgtc       600
     ggggctgatt acgaagcgat tgaacatcac ttaaataata ctatgttaaa agaagcgaac       660
     ttaaccacat ccgaatcgat gttgagagac gcaaacatcg cccgcgaaat gatgaactac       720
     ataagcggaa aaattcgaca acaaggagat tacctgctta tttcgcacat aaaccgcaat       780
     gtggaggaga cgttaaaatt attgacgtga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page