(data stored in SCRATCH zone)

EMBL: CP002293.PE351

CP002293.PE351       Location/Qualifiers
FT   CDS_pept        401490..401888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0363"
FT                   /product="flagellar protein FliS"
FT                   /note="KEGG: lsp:Bsph_1174 flagellar protein; TIGRFAM:
FT                   flagellar protein FliS; PFAM: flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73207"
FT                   /db_xref="GOA:A0A0F6BIF6"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF6"
FT                   /inference="protein motif:TFAM:TIGR00208"
FT                   /protein_id="ADP73207.1"
FT                   /translation="MTTQQFHQVYKQNSVSTASPGELTLMLYNGCLKFLNKAKQAMREG
FT                   NIQERNTNLQKAQRIIQELMATLNQKYEIAKQMMIMYEYMNRRLIEANIKNDISIVEEV
FT                   EGFVAEFRDTWEEVIRLTRQKQFKGDQV"
     atgactactc agcaatttca tcaagtttat aaacaaaata gcgtgagtac tgcttcgccg        60
     ggtgaattaa cattaatgct ttataacggt tgcctgaagt ttttaaacaa agccaaacag       120
     gcaatgcgtg aagggaacat acaagagcgg aatacgaatt tgcaaaaagc gcaaagaatt       180
     attcaagaac ttatggcgac attgaaccaa aaatacgaaa ttgccaaaca aatgatgatt       240
     atgtatgaat atatgaaccg gcggttgatt gaagcaaaca taaaaaatga catttccatc       300
     gttgaagaag tagaagggtt tgtggcagag tttcgtgata catgggaaga agtcattcgt       360
     ttaacccgcc aaaagcagtt taaaggagat caagtctaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page