(data stored in ACNUC7421 zone)

EMBL: CP002293.PE352

CP002293.PE352       Location/Qualifiers
FT   CDS_pept        401888..402241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0364"
FT                   /product="flagellar protein"
FT                   /note="KEGG: lsp:Bsph_1173 flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73208"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF7"
FT                   /inference="similar to AA sequence:KEGG:Bsph_1173"
FT                   /protein_id="ADP73208.1"
FT                   /translation="MDLIEQLVSCSESLLEVLQHSADERDKQVEKVEQLLAEREKIIAR
FT                   LKQGSYENLHQHPQARKIVEMEQDIQKGLRRLYEDIKMDLKRWNEKKRLQQSYENTFSY
FT                   VETYDGRFYDKRK"
     atggatttga ttgagcagct tgtctcttgt tcagaaagct tgctggaagt tcttcagcat        60
     tcagcggatg aacgtgacaa gcaagtggag aaagtggagc aattgttggc tgaaagggaa       120
     aaaattatcg ccagattaaa gcagggatca tatgaaaact tacaccagca tcctcaagcc       180
     cgaaaaattg tggaaatgga gcaagacatt caaaaagggt tgcgtcgttt atatgaggat       240
     ataaaaatgg atttgaaaag atggaacgaa aaaaaacgtt tacagcaatc ttatgagaac       300
     actttttcat atgtggaaac atatgatggc cgtttttacg ataagagaaa gtag             354
//

If you have problems or comments...

PBIL Back to PBIL home page