(data stored in ACNUC7421 zone)

EMBL: CP002293.PE353

CP002293.PE353       Location/Qualifiers
FT   CDS_pept        402434..402985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0365"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="KEGG: gwc:GWCH70_3010 sigma 54 modulation
FT                   protein/ribosomal protein S30EA; TIGRFAM: ribosomal subunit
FT                   interface protein; PFAM: sigma 54 modulation
FT                   protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73209"
FT                   /db_xref="GOA:A0A0F6BIF8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF8"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADP73209.1"
FT                   /translation="MIYNIRGENIEVTPALREYVEKKIGKLERYFENTENIHVHVNLKV
FT                   YNDKQGKIEVTIPMPQLLLRAEERHDDMYAAIDLVADKLERQIRKHKTKVNRKLRDRDK
FT                   EVKQVATVQTNAPAEDNEEEEFEIVRTKHFSLKPMDSEEAILQMNLLGHNFFIFTNAET
FT                   NRTNIVYRRKDGKYGLIEAN"
     atgatctata acattcgcgg ggaaaacatt gaagtgactc cggcattgcg tgagtatgtc        60
     gagaaaaaaa ttggaaagtt ggaaagatat tttgaaaata cggaaaacat tcatgttcac       120
     gtcaatttaa aagtatataa cgataaacaa gggaaaattg aagtgacgat cccgatgccg       180
     cagttgctgc tgcgcgcgga ggaacgccat gatgatatgt acgcggccat tgatttagta       240
     gcggataaat tggaacgaca aatccgcaaa cataaaacga aagtcaaccg caaattgcgc       300
     gatcgtgata aagaagtcaa acaagtggct accgtgcaaa caaacgctcc ggcggaggat       360
     aatgaggaag aagaatttga aattgtccgc acgaaacatt tcagcttaaa accgatggac       420
     agcgaagaag cgattttgca aatgaacttg cttggccata atttcttcat ctttacgaac       480
     gcggaaacaa accgcacgaa catcgtgtat cgccgcaaag acggaaaata cggtttaatt       540
     gaagcaaact ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page