(data stored in ACNUC7421 zone)

EMBL: CP002293.PE354

CP002293.PE354       Location/Qualifiers
FT   CDS_pept        403815..406328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0368"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="KEGG: gwc:GWCH70_3008 preprotein translocase, SecA
FT                   subunit; TIGRFAM: preprotein translocase, SecA subunit;
FT                   PFAM: SecA DEAD domain protein; SecA Wing and Scaffold;
FT                   SEC-C motif domain protein; SecA preprotein cross-linking
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73210"
FT                   /db_xref="GOA:A0A0F6BIF9"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF9"
FT                   /inference="protein motif:TFAM:TIGR00963"
FT                   /protein_id="ADP73210.1"
FT                   /translation="MLGVLKKVFDPNKRQLSRLEKIADQVDALGPEMAKLSDAELRQKT
FT                   EEFKARYQQGESLDDLLVEAFAVVREGAKRVLGLYPYKVQIMGGVVLHEGNIAEMKTGE
FT                   GKTLTATMPVYLNALTGRGVHVVTVNEYLATRDATEMGKLYEFLGLSVGLNLSGMSREE
FT                   KQAAYNADITYGTNNEFGFDYLRDNMVLYKEHIVQRPLHYAIIDEVDSILIDEARTPLI
FT                   ISGTAQKSTKLYIQANAFVRTLKKDVDYTYDEKTKSVQLTEEGITKAEKAFGIDNLFDL
FT                   KHVTLNHHINLALKAHVAMHRDVDYVVEDGKVVIVDPFTGRLMRGRRYSDGLHQAIEAK
FT                   EGLEIQNESMTLATITFQNYFRMYEKLAGMTGTAKTEEEEFRNIYNMQVVVIPTNKPVI
FT                   REDRPDLIFRTMEGKFRAVVEDIAQRHAKGQPVLVGTVSIETSELLSNMLKKRGIPHNV
FT                   LNAKNHAKEAEIIAQAGQKGAVTIATNMAGRGTDIKLGEGVKELGGLAVIGTERHESRR
FT                   IDNQLRGRSGRQGDPGVSQFYLSLEDELMRRFGSESLMSMMDRLGMDDSQPIQSKMVTK
FT                   AVESAQKRVEGNNFDARKQLLQYDDVLREQREIIYRQRYEVLDAENLRDIIEKMIQSVI
FT                   ERVVNTYTPKEELPEDWNLKGIVDYLNANLLPEGDVTVNDLRGKEPEEMIELIWEKVKA
FT                   RYDEKEQQIPPEQMREFERVIVLRAVDMKWMDHIDAMEQLRQGIHLRAYGQIDPLREYQ
FT                   MEGYAMFENMIASIEEEVAKYIMKAEIHSNLERQEVAKGEAVHPKEGEGETKRKPYRKA
FT                   VRIGRNDPCICGSGKKYKHCCGKNA"
     atgcttggag tattgaaaaa agtgtttgat ccgaacaaac gccagcttag ccgtttagaa        60
     aagatcgctg accaagtcga tgcgcttggc ccggagatgg caaagctttc tgatgccgag       120
     ttgcgccaaa agacggagga atttaaggcg cgctaccaac aaggggaatc gcttgatgat       180
     ttgttggttg aagcgtttgc cgtcgtgcgc gaaggggcaa agcgtgtcct tggattatat       240
     ccgtataaag tgcaaattat gggcggtgtc gtccttcatg aaggaaatat cgccgaaatg       300
     aaaacagggg aaggaaaaac gctgacggcg acgatgcctg tctatttaaa cgccttaacc       360
     ggaagaggcg tgcacgtcgt gacggtcaac gaatatttgg cgacccgcga cgcgacggaa       420
     atgggcaagt tgtacgagtt tcttggactt agcgtcggct tgaatttaag cggcatgtcg       480
     cgcgaagaaa agcaggcggc gtataatgcc gatattacgt acggaacgaa taacgagttc       540
     ggttttgact atttgcgcga taacatggtg ctttataagg agcatatcgt gcagcgcccg       600
     ctccattatg cgatcattga cgaagtggac tcgattttga ttgacgaagc gcggacgccg       660
     ctgattattt cgggaactgc gcaaaaatcg acgaagctgt atatccaggc gaacgcgttt       720
     gtgcgcacgc tgaaaaagga tgtcgattat acgtacgatg agaaaacgaa aagcgtacag       780
     ctgaccgaag aagggattac gaaagcggaa aaggcgtttg gcattgacaa cctgtttgac       840
     ttaaagcatg taacgctgaa ccatcatatt aatctggcgc ttaaagcgca tgtggcgatg       900
     caccgtgatg tggattacgt cgtggaagac ggaaaagtcg tcatcgtcga cccgtttacc       960
     ggccgcttga tgagagggcg ccgttacagc gacgggctgc atcaagcgat cgaggcgaaa      1020
     gaagggctgg aaatccaaaa cgagtcgatg acgcttgcga cgattacgtt ccaaaactac      1080
     ttccgcatgt atgaaaaatt agcggggatg acgggaacgg cgaaaacgga agaagaagag      1140
     ttccgcaaca tttataacat gcaagttgtc gtcattccga ccaacaaacc ggtcatccgc      1200
     gaagaccgcc cggatttgat tttccggacg atggaaggaa aattccgcgc tgtcgtggaa      1260
     gatatcgcac agcgccatgc gaaagggcag ccagtgctcg tcgggacggt gtcgattgaa      1320
     acgtcggaac tgctttcgaa catgttgaaa aaacgcggca ttccgcataa tgtattaaat      1380
     gcgaaaaacc atgcgaaaga ggcggaaatc attgcccaag ccggccaaaa aggcgccgtg      1440
     acgatcgcga caaacatggc tgggcgcggc acggatatta agctcggtga aggcgtgaaa      1500
     gagcttggcg gcttggcggt gatcggcacg gagcgccatg aaagccgccg cattgataac      1560
     cagctgcgcg gccgttcagg gcgccaaggc gacccgggcg tctcgcaatt ttacttgtcg      1620
     ctcgaagatg aactgatgcg ccgtttcggc tcagaaagct taatgtcgat gatggaccgg      1680
     ctgggcatgg atgattcgca gccgatccaa agcaaaatgg tcacgaaagc ggtcgagtcg      1740
     gcgcaaaaac gggttgaagg caacaacttc gatgctcgca agcagctgct tcaatacgac      1800
     gacgtgttgc gcgagcagcg cgaaatcatt taccgccagc gttatgaagt gctcgatgcc      1860
     gagaacctgc gtgatattat tgaaaaaatg atccaatccg tcattgagcg cgtcgtcaac      1920
     acttatacgc cgaaagaaga acttccggaa gactggaatt taaaaggaat tgtcgattac      1980
     ttgaacgcga atttgctgcc ggaaggcgat gtgaccgtta acgatttgcg cggcaaagag      2040
     ccggaagaaa tgattgagct gatttgggaa aaagtgaaag cgcgctatga tgaaaaagaa      2100
     cagcaaattc cgccggaaca aatgcgcgaa tttgaacgcg tcatcgtttt gcgcgccgtc      2160
     gatatgaaat ggatggatca tattgacgcg atggaacagc tacgccaagg cattcatttg      2220
     cgggcgtacg gacaaatcga tccgcttcgc gaataccaaa tggaaggata cgcgatgttt      2280
     gaaaacatga tcgcttccat tgaagaagaa gtggcgaaat atattatgaa agcggaaatt      2340
     cacagcaatc ttgagcgtca ggaagtggcg aaaggcgaag cggttcatcc gaaagaagga      2400
     gaaggggaaa cgaagcggaa accgtaccgg aaagcggtgc gcatcggccg caatgatcct      2460
     tgcatttgcg gaagcggcaa gaagtataaa cattgctgcg gcaagaatgc ctaa            2514
//

If you have problems or comments...

PBIL Back to PBIL home page