(data stored in ACNUC7421 zone)

EMBL: CP002293.PE356

CP002293.PE356       Location/Qualifiers
FT   CDS_pept        407871..408731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0370"
FT                   /product="Protein of unknown function DUF2179"
FT                   /note="PFAM: Protein of unknown function DUF2179; protein
FT                   of unknown function DUF161; KEGG: gwc:GWCH70_3006 protein
FT                   of unknown function DUF161"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73212"
FT                   /db_xref="GOA:A0A0F6BIG1"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIG1"
FT                   /inference="protein motif:PFAM:PF10035"
FT                   /protein_id="ADP73212.1"
FT                   /translation="MRRKNRLLHPKTELVIEYLCILIGSAIVAVAFNLFLLPNRVASGG
FT                   VSGISTIAHAVFGWQPAYVQWALNIPLFIAGVVLLGRQFGVKTLVGTLFLPLVVYLTKD
FT                   VEPATRDPLLGSLFGGIGVGLGLGIVFRGKASTGGTDLAAQIIHKYTGLSLGMCVVLID
FT                   GLIVSTAAFVFDIEQALYALIGLYVTSKTIDLVQVGLGSSKMAMIITNEEEKVRRAILH
FT                   EIDRGVTRLSGYGGYTDHERPVLMCVVQQAEFTKLKQLVKTIDPSAFVIVMNAAEVLGE
FT                   GFKRT"
     atgagaagaa aaaatcggct attgcatccg aaaacggagc ttgtcataga atatttgtgc        60
     atattgattg gttcggcgat agtcgccgtg gcgtttaatc tttttttatt gccaaaccgc       120
     gtcgcctccg gcggtgtcag tggaatcagc acgatcgccc atgcggtgtt cggctggcag       180
     cctgcctatg tgcaatgggc gctcaacatt cctttgttca ttgccggagt tgttttgctt       240
     ggcaggcaat ttggggtgaa gacgcttgtc ggcacattgt ttttgccgct tgttgtctat       300
     ttgacgaaag atgttgaacc agccacccgt gacccgctgc ttggttcgct gtttggcggc       360
     attggcgtcg ggcttggcct tggcattgtg tttcgcggca aagcgtcaac aggagggacc       420
     gatttggcgg cgcaaatcat tcataaatac accggattgt ccctcggcat gtgcgtggta       480
     ttgatcgacg ggcttatcgt atcaaccgca gcgtttgtct ttgatattga acaagcgctg       540
     tatgcgctca tcggccttta tgtgacaagc aaaacgatcg atttagtgca agtcgggctc       600
     ggcagctcaa aaatggcgat gattattacc aatgaggaag aaaaagtgcg ccgcgcgatt       660
     ttgcatgaaa ttgaccgcgg cgtcacaagg ctgtcggggt atggcggcta taccgaccat       720
     gaacgcccgg tgttgatgtg tgtggtgcag caagcggagt tcacaaaatt gaaacaattg       780
     gtgaaaacca ttgatccatc agcgtttgtc attgtgatga acgccgccga agtgctcggg       840
     gaaggattta agcgcacgta a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page