(data stored in ACNUC7421 zone)

EMBL: CP002293.PE36

CP002293.PE36        Location/Qualifiers
FT   CDS_pept        48372..49574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0036"
FT                   /product="G5 domain protein"
FT                   /note="PFAM: G5 domain protein; 3D domain-containing
FT                   protein; protein of unknown function DUF348; KEGG:
FT                   gwc:GWCH70_0035 3D domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72892"
FT                   /db_xref="GOA:A0A0F6BHJ1"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ1"
FT                   /inference="protein motif:PFAM:PF07501"
FT                   /protein_id="ADP72892.1"
FT                   /translation="MILPNMKRISDSLRKNFTVTASSFIAFSATTGLAGYEIAKDDVTL
FT                   TVNGKKQEIRTHAKTVKEVLQEQNIKPRKEDHVYPSLDTPITDDLNIVWEASKKVTLIV
FT                   DGKKQEIWTTAKNVGELLNSQHITLGKHDKIAPSPNAEIKKGMEVNVEKAFPVQLNVGG
FT                   KQKQVWATSTTVADFLKQQNVKLGELDRVEPSLQEKVKEGMIVKVVKVQKVTDVVEEPI
FT                   DFAVVTRRDAQLPKGEQRVISPGEKGKALKRYEVVLENGKEVSRKLIETKLMKASKNRI
FT                   VAIGTRSTHARPVQIASRGQRHATKEFYVTATAYTAYCEGCSGTTSTGIDLRANPSAKV
FT                   IAVDPRIIPIGSKVYVEGYGYAIAGDTGSSINGYKIDVFFPKKSDAFRWGKKRVKVKII
FT                   Q"
     atgatattac ccaatatgaa gagaatttct gactcattga ggaaaaactt cacggttacc        60
     gctagtagtt tcatagcctt ttcagcgaca acgggacttg ccgggtatga aatagcgaag       120
     gatgacgtga cgctgacggt gaatggaaaa aaacaagaga ttcgcactca cgccaagacg       180
     gtaaaagaag tattacagga gcaaaacatt aagccaagaa aagaagatca cgtctatcca       240
     tcgctagata cgccaattac agatgattta aacattgttt gggaagcgag caagaaagta       300
     acgttgatag tggatgggaa aaaacaagaa atatggacga ctgcaaaaaa cgttggcgag       360
     ctgttaaact cgcaacatat taccctcgga aagcatgaca aaattgctcc gtcgccaaat       420
     gcagagatca aaaaaggaat ggaagtgaat gtggaaaaag catttccagt ccaattaaat       480
     gttggcggca aacaaaaaca agtatgggca acttctacta ctgtcgctga ctttttaaaa       540
     caacaaaacg tgaaattagg cgaactcgac cgtgttgaac catctttaca agagaaagta       600
     aaagaaggca tgattgtaaa agtggtgaaa gttcaaaaag tcaccgatgt agtggaagaa       660
     ccaattgatt ttgcagtcgt cactcgccga gatgcgcaat tgccaaaagg agaacagcgt       720
     gtgatcagtc cgggtgaaaa aggaaaagct ttgaaaaggt atgaagtagt gctggaaaac       780
     ggaaaagaag tatcgcgaaa acttatagaa acaaaattga tgaaagcaag caaaaatcgc       840
     attgttgcaa tcggaacacg atccactcat gcgcgccctg ttcaaatagc gtcgcgcggt       900
     caaaggcatg caacaaaaga attttatgtt actgccaccg cttacaccgc ttattgtgaa       960
     ggctgctcgg gaacaacgag cacaggaatt gatttgcgcg caaacccttc tgcgaaagtg      1020
     attgcggttg acccgagaat tataccgatc ggatccaaag tgtacgttga agggtatgga      1080
     tatgccattg ctggagacac aggatcgagc attaatggtt ataaaattga cgtgtttttc      1140
     ccgaaaaaat cggacgcgtt tcgttggggc aaaaaacgcg taaaagtgaa aattattcaa      1200
     taa                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page