(data stored in SCRATCH zone)

EMBL: CP002293.PE364

CP002293.PE364       Location/Qualifiers
FT   CDS_pept        complement(415333..415731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0378"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: bmq:BMQ_3973
FT                   GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73220"
FT                   /db_xref="GOA:A0A0F6BIG9"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIG9"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ADP73220.1"
FT                   /translation="MNQPFLRFLLVSIIHTAAGLSIMHLLYRLPHVPYWQATLAGIAAS
FT                   AVISYILNRTFTFQSNVSIIKSTFRFIAVMIVCYYCSYRLSTQLTDWAALTAGIISPRL
FT                   ANNAAILLGAGFYTILNYIGQKQFVFFR"
     atgaaccagc cgtttctgcg ctttttgctt gtcagcatca tccacactgc ggccggatta        60
     tcgatcatgc atcttcttta tcgtctcccc cacgttccgt attggcaggc aacattggcc       120
     ggcattgcgg ccagtgcggt catcagctac atactgaacc gaacgtttac gtttcaaagc       180
     aatgtctcca ttatcaaaag cacgttccgc tttatcgcgg tcatgatcgt atgctattat       240
     tgttcgtacc gcctgagcac acagctcact gattgggcgg cgctgacagc cggcatcatt       300
     tccccccgtc tggcgaacaa tgccgcgatt ttgcttggcg cgggatttta tacgattttg       360
     aattatatcg ggcaaaaaca gtttgtattt tttcgttaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page