(data stored in ACNUC7421 zone)

EMBL: CP002293.PE366

CP002293.PE366       Location/Qualifiers
FT   CDS_pept        complement(416738..418414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73222"
FT                   /db_xref="GOA:A0A0F6BIH1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH1"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3179"
FT                   /protein_id="ADP73222.1"
FT                   /translation="MGMKRNERTAIGIALLLLAVYLSPLYILGEDAHIRVHDNMDSNIA
FT                   WYKVLARSGELFGPLNATIPQVINGLPRNAFGTEFSGIVWLHALFPSMVAYALSQTITR
FT                   VFAFIGMYALLKRHFLPDEESYLIRVGASLAFALTPFWPSGMLSTLGMPLALWAFLTIR
FT                   KGEATWKEWLVLVLLPFYASFVLGFFFFLAAMALLWLRDIIVQKRWNWPFFGAIALMTV
FT                   IFFAIEYRLVYSLVFGEEPTSRNEFLSSRLSFLHCVRLTFKNYLLGHTHVMTVHTFVIL
FT                   PILWITFFFAWAKRSETLEKQFIFLFVLNFVLSTWYAFWFYKGWQPLKERISLLNTFNF
FT                   ARFHFLRPMVIYLDFALALQILWKQGIRWRRVVPAALALQLLILGGFNEEIRYRLIGTP
FT                   SFKEFYAEHLFNEIKQYIGKPQSSYRVASVGLHPAIAQYNGFYTLDTYNNFYPLSYKHQ
FT                   FRKIIAKELDKSPVLQDYFDHWGNRVYLFSAELGKHYMFRKTSHKKIHHFDINTKVFKQ
FT                   MGGRYIFSSVPIMNAKEIHLRLLRTFEDSQAAWKIYVYEVE"
     atgggaatga agcgaaacga acgaacagcg atcggcatcg ctttgcttct tttagctgtt        60
     tacctttctc cgctttatat acttggggaa gatgcgcaca tccgggtaca tgacaacatg       120
     gactccaaca ttgcttggta taaagtgctg gcgcgaagcg gcgagctgtt cggcccgctc       180
     aacgccacga ttccgcaagt gattaacggg ctgccgcgca acgcgtttgg caccgaattc       240
     agcggcatcg tttggctcca tgcgctgttc ccttcgatgg tcgcatatgc gctcagccag       300
     acgatcaccc gtgtttttgc gtttatcggc atgtatgcct tgctaaaaag gcacttcctt       360
     ccagatgaag agtcttatct catccgcgtc ggcgcgtcac tggcatttgc actcactccg       420
     ttttggccgt cgggaatgtt gagcacactc ggcatgccgc tggcgctatg ggcgttttta       480
     acgatccgga aaggcgaagc gacatggaaa gaatggcttg ttcttgtgct gctgccgttt       540
     tacgctagct tcgtgctcgg atttttcttc tttcttgccg caatggcgct gctatggctg       600
     cgtgacatca tcgtccaaaa gcggtggaac tggccgtttt ttggcgcgat tgcgttgatg       660
     acagtcattt ttttcgccat tgaatatcgt ctcgtttatt ctctcgtatt tggcgaagaa       720
     ccgacaagcc gcaacgaatt tctttcttcg cggctcagtt ttcttcattg cgtgcggctt       780
     acgttcaaaa actacttgct tggccatacg catgtgatga ccgtgcatac gtttgtcatt       840
     cttcctatct tatggatcac tttctttttc gcttgggcga agcggagcga aacgcttgaa       900
     aaacagttta ttttcctgtt tgtgctgaac tttgtcttgt cgacatggta cgcgttttgg       960
     ttttacaaag gatggcagcc gttaaaagaa cgcatttctt tgttaaatac gtttaatttt      1020
     gcccgctttc actttttgcg gccaatggtc atctatttag attttgcgtt ggcgctgcaa      1080
     attctctgga aacagggaat ccggtggcgg cgtgtcgttc ctgccgcttt ggcgctccag      1140
     ctgttgattc ttggcggctt taacgaagaa atccgctacc gcctcatcgg cactccttcg      1200
     tttaaagaat tttacgcgga acatttgttt aacgaaatca aacaatatat cggcaaacca      1260
     caaagttcct accgcgtcgc cagcgtcggg cttcatccgg cgatcgcgca atataacggg      1320
     ttttacacgc tcgatacgta taacaatttt tatccgttgt cttataagca tcaatttcgc      1380
     aaaattatcg ccaaagagct cgataaaagc cctgttcttc aagattactt tgaccattgg      1440
     ggcaaccgcg tctatctgtt ctccgccgag cttggcaagc attacatgtt ccgcaaaaca      1500
     tcgcataaaa aaattcatca tttcgatatc aatacgaagg tgtttaagca gatgggaggg      1560
     cgctatattt tctcttccgt cccaatcatg aacgcgaaag aaattcacct ccgattgtta      1620
     agaacgttcg aagattcgca agctgcttgg aaaatttatg tatatgaagt ggaataa         1677
//

If you have problems or comments...

PBIL Back to PBIL home page