(data stored in ACNUC7421 zone)

EMBL: CP002293.PE368

CP002293.PE368       Location/Qualifiers
FT   CDS_pept        419298..420485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0382"
FT                   /product="PDZ/DHR/GLGF domain protein"
FT                   /note="SMART: PDZ/DHR/GLGF domain protein; KEGG:
FT                   gwc:GWCH70_2994 PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73224"
FT                   /db_xref="GOA:A0A0F6BIH3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH3"
FT                   /inference="protein motif:SMART:SM00228"
FT                   /protein_id="ADP73224.1"
FT                   /translation="MSIWVLEALKGVLRLFAQPLFYFGIVLALAAGWRRVKRERKHFHI
FT                   RVYSPFQESKFFWRSGLAAGLILSLAAVAAGIALPRDAVSLIALVTVAFGLTLQMRLLS
FT                   PAYTVGTALLIISFLASNKEVFPAMKRFFPDLAEANMAALAMLLALLLFVEAWLILRNG
FT                   AIETSPQLAKSKRGLVVGEHWSQRLWLIPVLLPVSGELPPPFSWWPLFPYDEGSYSLML
FT                   VPFLIGFSQRVQGTLPKASIRFAGQKVLLLAWGVSLFAVGGYWYAPLSIVAAALALAGR
FT                   EWLAFYLHRQDRLKPPHFAKREHGLVILGILPHSKAEKMELQIGEVIMKVNGMPVKTEA
FT                   EFYEALQRNRAFCKLEVMDENEEIRFVQGALYEDEHHELGLLFVKERKKWALEAV"
     atgtccatat gggtgttgga ggcgctcaaa ggcgttttgc ggctatttgc gcagccgttg        60
     ttttactttg ggatagtgct ggcgcttgcc gctggatggc ggcgtgtaaa gcgggaaaga       120
     aagcattttc atattcgcgt gtacagtccg tttcaggaaa gcaaattttt ttggcggagc       180
     ggcctcgccg ctgggttgat tttatcgttg gcggcggtcg ctgccggcat cgcgttgccg       240
     cgcgatgccg tttcgctcat tgcccttgtg acggtcgcgt ttggattgac gttgcaaatg       300
     cggctgcttt ctccggcgta tacggtggga acggcgctgt tgatcattag ttttctggca       360
     agcaataaag aggtctttcc agctatgaaa cgcttttttc ctgatcttgc cgaggcgaat       420
     atggcggcgc tcgccatgtt gcttgcttta ttgctttttg ttgaagcgtg gctgatttta       480
     cgcaacggcg ccatcgaaac gtctccgcag ctggcgaaaa gcaagcgcgg cttggtcgtc       540
     ggggagcact ggtcacagcg gctttggctc attcctgtgt tgctgccggt gtccggggaa       600
     cttccgcccc cgttttcatg gtggccgttg tttccttatg atgagggttc ttattcattg       660
     atgcttgtgc cgtttttaat cggcttttcc cagcgtgtcc aagggacgct tccgaaagct       720
     tccattcgtt ttgccggcca gaaagtgctg ctgctggcat ggggggtgag cctgtttgcc       780
     gttggcgggt attggtatgc gccgctttcc atcgtggcgg cggcgcttgc gctggccgga       840
     agggaatggc ttgcttttta tctgcatcgg caagaccgtt tgaaacctcc gcattttgca       900
     aagcgggaac atgggcttgt cattttaggc attcttccgc actcgaaggc ggaaaaaatg       960
     gaactgcaaa ttggcgaagt gatcatgaaa gtgaacggga tgccggtaaa aacggaagcg      1020
     gaattttatg aagcgttgca acgaaaccgg gcattttgta aattagaagt aatggatgaa      1080
     aacgaagaaa tccgtttcgt ccaaggggcg ttatatgagg acgaacatca tgagcttggg      1140
     ctgttgtttg tcaaagaacg gaaaaaatgg gcgttagaag ccgtctaa                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page