(data stored in ACNUC7421 zone)

EMBL: CP002293.PE369

CP002293.PE369       Location/Qualifiers
FT   CDS_pept        420501..420722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0383"
FT                   /product="Protein of unknown function DUF2198"
FT                   /note="PFAM: Protein of unknown function DUF2198; KEGG:
FT                   gwc:GWCH70_2993 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73225"
FT                   /db_xref="GOA:A0A0F6BIH4"
FT                   /db_xref="InterPro:IPR019242"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH4"
FT                   /inference="protein motif:PFAM:PF09964"
FT                   /protein_id="ADP73225.1"
FT                   /translation="MWFLIALIVPCLLVLLFTRVTYNHYIGTLLTVALLVASYFKGYTD
FT                   DLHEILADIVSTTVGFLYARKMVKQLKK"
     atgtggtttt tgattgcatt aattgtgcca tgtttgcttg tgctgttatt tacccgcgtc        60
     acgtacaatc attatatcgg aacattattg acagtcgcgt tgcttgtcgc atcttatttt       120
     aaaggataca cggacgatct gcatgaaatt ttggcggata tcgtatccac gacggttggg       180
     tttttgtatg cgcggaaaat ggtgaaacag ttaaaaaaat aa                          222
//

If you have problems or comments...

PBIL Back to PBIL home page