(data stored in ACNUC7421 zone)

EMBL: CP002293.PE371

CP002293.PE371       Location/Qualifiers
FT   CDS_pept        422864..425728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0385"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: gwc:GWCH70_2991 excinuclease
FT                   ABC, A subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73227"
FT                   /db_xref="GOA:A0A0F6BIH6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH6"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ADP73227.1"
FT                   /translation="MATDKIIVKGARAHNLKNIDVEIPRDKLVVLTGLSGSGKSSLAFD
FT                   TIYAEGQRRYVESLSAYARQFLGQMDKPDVDAIEGLSPAISIDQKTTSRNPRSTVGTVT
FT                   EIYDYLRLLFARIGRPVCPEHGIEITSQTIEQMVDRLLSYPERTKMQILAPIVSGRKGT
FT                   HAKTLEDIRKQGYVRVRVDGEMRELTETIELEKNKKHSIEVVVDRIIIKDGIATRLADS
FT                   LETALKLADGKVLIDVIGQEELLFSEKHACPYCGFSIGELEPRLFSFNSPYGACPDCDG
FT                   LGATLEVDPDLVIPNNELSLREHAIAPWEPQSSQYYPQLLEAVCNHYGIDMDVPVKDLP
FT                   KEQLDKILYGSGGEKIYFRYQSDFGQIREQYIVFEGVIPNVERRYRETSSDYVREQMEK
FT                   YMAQQPCPTCKGNRLKKESLAVLVGGKHIGEVTALSVTEALAFFENLQLSEKEQKIAHL
FT                   ILREIRERLGFLKNVGLDYLTLNRSAGTLSGGEAQRIRLATQIGSRLTGVLYVLDEPSI
FT                   GLHQRDNDRLIATLKSMRDIGNTLIVVEHDEDTMLAADYLIDIGPGAGIHGGRVVAAGT
FT                   PQEVMNNPDSLTGQYLSGKKFIPIPSERRKPDGRWIEVVGAKENNLKNVSVKIPLGTFV
FT                   AVTGVSGSGKSTLVNEILYKALAQKLQRAKAKPGEHKTIKGLEHLDKVIDIDQSPIGRT
FT                   PRSNPATYTGVFDDIREVFAATNEAKVRGYKKGRFSFNVKGGRCEACHGDGIIKIEMHF
FT                   LPDVYVPCEVCHGKRYNRETLEVTYKGKNIAEVLEMTVEDALEFFGNIPKIKRKLQTLY
FT                   DVGLGYMKLGQPATTLSGGEAQRVKLAAELHRRSTGRTLYILDEPTTGLHVDDIARLLK
FT                   VLQRLVDNGDTVLVIEHNLDVIKTADYIIDLGPEGGEQGGQIVATGTPEEVAEAKHSHT
FT                   GRYLKPILERDRERMRALYETAKA"
     atggcaacgg ataaaatcat cgtcaaaggt gcgagagccc ataatttaaa aaatatcgac        60
     gtcgaaattc cccgtgacaa gctcgttgtt ttaacggggc tttccggttc ggggaaatcg       120
     tcgcttgcgt ttgatacgat ttatgcggaa gggcagcggc gctatgtcga atcactttcg       180
     gcatacgccc gccagttttt agggcaaatg gataagccgg atgtcgatgc gattgaaggg       240
     ctgtcgccag cgatttcgat cgaccagaaa acgacaagcc gcaatccgcg ttcgactgtc       300
     ggaacggtca cggaaattta tgattatttg cggcttttgt ttgcccgcat cggccgtccg       360
     gtttgtccgg agcatggcat cgaaattaca tcgcagacga tcgagcagat ggtcgaccgg       420
     cttctttcct atccagaacg gacgaaaatg caaattctcg ctcctatcgt ctccgggcgg       480
     aaagggacgc atgcgaaaac gctggaggat attcgcaagc aagggtatgt gcgcgtgcgc       540
     gtcgacgggg aaatgcggga gcttacagaa acgattgagc ttgagaaaaa taaaaaacat       600
     tcgattgagg tcgtcgtcga ccggattatt attaaagacg ggattgctac acgtttggca       660
     gattcattag agacggcttt gaagcttgcg gacggaaaag tgctgattga tgtcattggc       720
     caggaagagc tgctgtttag cgaaaaacat gcgtgcccgt attgcggctt ttcgattggc       780
     gagcttgagc cgcgcctgtt ttcgtttaac agcccgtacg gcgcctgccc ggattgcgac       840
     ggccttgggg cgacgcttga agtcgatccc gatttagtca ttccgaacaa tgagctgtca       900
     ttgcgcgagc acgccatcgc tccgtgggag ccgcaaagct cgcaatatta tccgcagctg       960
     ttagaagcgg tgtgcaacca ttacggcatt gacatggacg tgccggtaaa agatttgccg      1020
     aaagagcagc tcgataaaat tttatacggc agcggcggcg agaaaattta cttccgctat      1080
     cagagcgact tcgggcaaat tcgcgagcaa tatatcgttt ttgaaggggt tattccgaac      1140
     gtggagcgcc gctatcggga aacaagttct gattatgtcc gcgaacaaat ggaaaaatat      1200
     atggcgcagc agccatgtcc gacgtgcaaa ggaaaccgct tgaaaaaaga gagcctcgcc      1260
     gttctcgtcg gcggcaaaca tatcggcgaa gtgacggccc tctccgttac ggaggcgctt      1320
     gcctttttcg aaaacttgca gctgagcgaa aaagaacaaa aaatcgccca tctcattttg      1380
     cgcgaaatcc gcgagcgcct cggcttttta aagaacgtcg gcctcgatta tttaacactc      1440
     aaccgctccg ccggaacgct ttctggcgga gaagcgcagc gcattcgtct ggcgacgcaa      1500
     atcggctcgc gcttaaccgg ggtgctttac gttttggacg agccgtcgat tgggctccat      1560
     cagcgcgata atgaccgttt gattgcgacg ctgaaaagca tgcgcgacat cggcaacacg      1620
     cttattgtcg ttgagcatga cgaagatacg atgcttgccg ctgattattt aattgatatt      1680
     gggccgggtg cgggcattca tggcggccgc gtcgttgcgg ccggaacgcc gcaagaagtg      1740
     atgaacaacc cggactcgct caccgggcaa tatttatcgg ggaaaaaatt catccctatt      1800
     ccgagcgagc gccgcaaacc ggatggacga tggattgagg ttgtcggcgc gaaagaaaat      1860
     aacttgaaga atgtgtcggt gaaaatcccg ctcggcacgt ttgtcgcggt caccggcgta      1920
     tccggttccg gaaaaagcac gctcgtcaat gaaattttgt ataaggcgct tgcgcaaaaa      1980
     ttgcagcgcg cgaaggcgaa accaggagag cataaaacga tcaaagggct tgaacattta      2040
     gacaaagtca ttgacattga ccaatcgccg atcggccgca cgccccgctc caacccggcg      2100
     acatatacgg gcgtgtttga cgatattcgc gaagtgtttg cggcgacgaa tgaagcgaaa      2160
     gtgcgcgggt ataaaaaagg ccgcttcagc tttaacgtca aaggcgggag atgcgaagcg      2220
     tgccacggtg acggcattat taaaatcgaa atgcactttt tgccggatgt gtatgttccg      2280
     tgtgaagtat gccatggcaa acggtataac cgcgaaacgc tggaagtgac atacaaagga      2340
     aaaaatattg cggaagtgct tgagatgaca gtggaagatg cgcttgagtt tttcgggaat      2400
     atcccgaaaa ttaagcggaa attacagacg ctgtatgatg tcggtttagg gtatatgaag      2460
     cttgggcagc cggcaacgac gttgtcgggc ggagaagcgc agcgcgtcaa attggctgcc      2520
     gaattgcacc gccgttcgac aggccggacg ctctatattt tagacgagcc gacgaccggg      2580
     cttcacgtcg acgacattgc ccgcttattg aaagtgctgc agcgcctagt cgataacggg      2640
     gataccgttc tcgtgattga gcacaatctc gatgtcataa aaacggcgga ctacattatc      2700
     gatcttggcc cggaaggcgg cgaacaaggc gggcaaatcg tggcgacggg aacgccggaa      2760
     gaagtggctg aagcaaaaca ttcgcatact ggccgttatt taaaaccgat tttggagcgc      2820
     gaccgcgaac ggatgcgggc attgtatgaa acggcaaagg cataa                      2865
//

If you have problems or comments...

PBIL Back to PBIL home page