(data stored in SCRATCH zone)

EMBL: CP002293.PE374

CP002293.PE374       Location/Qualifiers
FT   CDS_pept        427280..427639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0388"
FT                   /product="membrane protein of unknown function"
FT                   /note="PFAM: membrane protein of unknown function; KEGG:
FT                   gwc:GWCH70_2988 membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73230"
FT                   /db_xref="GOA:A0A0F6BIH9"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH9"
FT                   /inference="protein motif:PFAM:PF04020"
FT                   /protein_id="ADP73230.1"
FT                   /translation="MINWLIGVFVNTVLLMAIDGYFDSIQFSGIGAAFIASMILSILNI
FT                   VVRPVLILLTLPVTILTLGLFLFVINAITLLMTAALMGNAFEIDGFGTALLASIVLSFF
FT                   HLLVQKAIIEPLLQK"
     atgattaatt ggttgattgg cgtatttgtg aacacggttt tattgatggc gattgacggg        60
     tattttgatt ccattcaatt tagcggcatc ggcgccgcat ttattgcgag catgatttta       120
     tccattttaa acattgtcgt gcgccctgtt ttaattttac tgacattgcc tgtgacgatt       180
     ttgacgctcg gattattttt gttcgtcatt aacgcgatta ctttgctgat gacggcggcg       240
     ttaatgggca atgcctttga aattgacgga ttcggcacgg cgctcctcgc ttcgattgtt       300
     ctttcctttt tccatttgct cgtgcaaaaa gcgatcattg agccattgct gcaaaaataa       360
//

If you have problems or comments...

PBIL Back to PBIL home page