(data stored in ACNUC7421 zone)

EMBL: CP002293.PE375

CP002293.PE375       Location/Qualifiers
FT   CDS_pept        427757..428692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0389"
FT                   /product="HPr kinase"
FT                   /note="KEGG: gwc:GWCH70_2987 HPr kinase; TIGRFAM: HPr(Ser)
FT                   kinase/phosphatase; PFAM: HPr serine kinase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73231"
FT                   /db_xref="GOA:A0A0F6BII0"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII0"
FT                   /inference="protein motif:TFAM:TIGR00679"
FT                   /protein_id="ADP73231.1"
FT                   /translation="MPKVRTKDIIEKFQLELVSGAEGIYRPITTSDLSRPGIEMAGYFA
FT                   YYPAERIQLLGRTELSFYETLSPEEKKIRMERLCTDITPGIIVSRGLEVPPELIEASER
FT                   QSVPVMRSTMKTTRLSSRLTNYLESKLAPTTAVHGVLVDVYGVGVLITGKSGVGKSETA
FT                   LELVKRGHRLVADDCVEIRQEDEGMLVGSAPELIEHLLEIRGLGIINMMTLFGAGAVRT
FT                   HKRISLVIDLELWDPNKQYDRLGLEEEKVKILDTELPKLTIPVRPGRNLAVIVEVAAMN
FT                   FRLKRMGVNAAEEFSARLTDAIEDGEHDYE"
     atgccgaaag tgcgcacaaa agatattatc gaaaagttcc agctggaatt ggtgagcggt        60
     gcggaaggaa tttaccgacc gataacaacg agcgacttat cccgccctgg cattgaaatg       120
     gcgggctatt tcgcgtatta tccggccgag cggattcagc tgttaggcag aacggagctt       180
     tcgttttatg aaacattgag cccggaagag aaaaaaatca gaatggagcg gctctgtacc       240
     gatattactc cagggattat cgtatcgcgc gggctggaag ttccgccgga attgatcgaa       300
     gcttccgagc gacaatcggt gccggtgatg cgttcaacga tgaaaacgac acgcctttca       360
     agccgcttga caaactattt ggaaagtaaa ttggcgccga caacagcggt tcacggtgtg       420
     ctggtcgatg tctacggcgt cggagtatta atcactggca agagcggagt tggcaaaagc       480
     gaaacagcgc ttgaattagt caaacgcggt caccggctcg tcgcagatga ctgtgttgaa       540
     attcgccaag aagatgaagg gatgctcgtt ggcagtgcgc cagagttgat tgagcattta       600
     ctggaaatcc gcgggttagg cattattaat atgatgacat tgtttggcgc tggagcggtg       660
     cggacgcata agcgcatttc attagtgatc gatttggaac tttgggatcc gaataaacaa       720
     tacgatcgcc tcggattgga agaagaaaaa gttaaaattc ttgatacaga attgccgaaa       780
     ttaacgatac cggtgcggcc ggggcgaaat ctggcggtga ttgtcgaagt ggccgcgatg       840
     aatttccgct tgaagcgaat gggggttaac gcggcggagg agttttccgc gcgcctgacc       900
     gatgcgattg aagatgggga gcatgattac gaataa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page