(data stored in ACNUC7421 zone)

EMBL: CP002293.PE376

CP002293.PE376       Location/Qualifiers
FT   CDS_pept        428715..429524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0390"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="KEGG: gwc:GWCH70_2986 prolipoprotein diacylglyceryl
FT                   transferase; TIGRFAM: prolipoprotein diacylglyceryl
FT                   transferase; PFAM: prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73232"
FT                   /db_xref="GOA:A0A0F6BII1"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII1"
FT                   /inference="protein motif:TFAM:TIGR00544"
FT                   /protein_id="ADP73232.1"
FT                   /translation="MDATIQPLDRVFLHLGPITIYWYGVIIGAGVLIGLWLATREGERR
FT                   GLPKETFVDLVMFAVPVAILCARAYYVIFEWSYYSKHLSEIPKIWEGGLAIHGGLLGAV
FT                   ATGIVFAKVKGLSFWKLADIAAPSIILGQAIGRWGNFMNQEAHGGPVTREFLESLHLPD
FT                   FIINQMYINGQYYHPTFLYESLWNVAGFLLLLWLRRVNLRRGELFLSYLIWYSAGRFYI
FT                   EGMRTDSLMLTSHLRMAQVVSVMLIILSVCLWVYRRKKGLAKERYSD"
     atggatgcga cgattcaacc gcttgaccgt gtttttttgc atctcggtcc gatcacgatt        60
     tattggtatg gcgtcattat cggagcgggt gtgttgatcg ggctgtggct ggcgacgagg       120
     gagggggagc ggcgcggact ccccaaagaa acgtttgttg accttgttat gtttgcggtg       180
     ccggtcgcca ttttatgcgc gcgcgcctat tatgtgattt ttgaatggag ttattattcg       240
     aaacatctat cggaaatccc gaaaatttgg gaaggcggtc tcgcgattca cggcggattg       300
     ctcggcgcgg tcgcgacagg aatcgtcttt gcgaaagtga aggggctttc attctggaag       360
     ctcgcggaca ttgcggcgcc aagcattatt ttagggcagg cgatcgggcg ctggggcaat       420
     tttatgaatc aggaagcgca cggcgggccg gtaacgaggg aatttttgga aagtttgcat       480
     ttgccggatt ttatcattaa tcaaatgtat attaacggcc aatattacca tccgacgttt       540
     ttatacgagt cgctttggaa tgttgccggt tttttgctac tgttgtggct gcggcgcgtc       600
     aatctgcggc gcggcgaatt gtttctcagc tatttaattt ggtattcggc cgggcggttt       660
     tacattgaag ggatgcgcac cgatagtttg atgttgacaa gtcatcttcg catggcgcaa       720
     gttgtttctg ttatgcttat tatactttcg gtatgtttat gggtatatcg aagaaagaaa       780
     gggttggcaa aagagcggta tagcgattag                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page