(data stored in ACNUC7421 zone)

EMBL: CP002293.PE377

CP002293.PE377       Location/Qualifiers
FT   CDS_pept        429543..430481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0391"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   gwc:GWCH70_2985 nucleoside recognition domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73233"
FT                   /db_xref="GOA:A0A0F6BII2"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII2"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ADP73233.1"
FT                   /translation="MVGILRRGFAVGLQTTWTLGKVIFPITLIVSVLQHTPVLQWIIQL
FT                   VAPLMKWIGLPGDAAIPLVLGNLLNLYAAIGAILTLDLTVKEVLILAVMLSFSHNLLIE
FT                   STVASRTGMSIALMVAVRLSLAIIAALLIHHLWQGGSEAAQYGFVSNSPEQLAGWGAIL
FT                   LAGVKKACLGIVQLAAIVIPLMIGIQILKELEWIHVFSRWMAPLTKMLGMKENTSLTLA
FT                   AGLVFGLAYGAGVMIQAVKEDGVSKRDLTLAFIFLISCHAVIEDTLVFVPLGIPVWPLL
FT                   VIRLATAMLLTMLISFIWNRGKEAKRKEATL"
     atggttggga tattacggcg ggggtttgcc gttggattgc aaacaacatg gacgcttgga        60
     aaagtgattt ttcctatcac gctcattgta tccgttttgc aacatactcc tgtattgcaa       120
     tggatcattc agcttgtcgc gccgttaatg aagtggatcg ggcttccagg agacgcggca       180
     attccgcttg tgctcggcaa cttattaaac ttgtatgcgg caattggcgc gattttaacg       240
     ttggatttaa cggtaaaaga agtgctgatt ttagctgtca tgctttcgtt ttcccacaat       300
     ttgcttatcg agtcgactgt tgcctcaaga acgggaatga gcattgcgtt aatggtcgcc       360
     gtccgcctca gtctggcaat cattgctgcg ctattgattc atcatctttg gcaaggagga       420
     agtgaggcgg cgcaatatgg ctttgtttcc aactctccag agcagctggc gggctggggg       480
     gctattttgc ttgccggggt gaaaaaagcg tgccttggga tcgtgcagct ggcggcgatc       540
     gtgattccgc tgatgattgg aattcaaata ttgaaagagt tagaatggat tcatgttttt       600
     tcacgctgga tggcgccgtt gacaaaaatg ctcggcatga aagaaaacac ttcattgaca       660
     ttggcggctg ggctcgtgtt tggtctggca tacggtgcag gcgtgatgat tcaggcggtc       720
     aaagaagacg gggtatcgaa gcgtgatttg acgctggcgt ttatttttct catatcttgc       780
     cacgcggtta tcgaagacac gcttgtgttt gtgccgcttg gcattcctgt gtggccgctg       840
     cttgtcatcc gtttggcgac cgccatgtta ttaacgatgc ttatcagctt tatttggaac       900
     cgcgggaagg aagcaaaaag gaaggaagcg acattatga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page