(data stored in ACNUC7421 zone)

EMBL: CP002293.PE38

CP002293.PE38        Location/Qualifiers
FT   CDS_pept        50354..51241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0038"
FT                   /product="dimethyladenosine transferase"
FT                   /note="SMART: Ribosomal RNA adenine methylase
FT                   transferase-like; TIGRFAM: dimethyladenosine transferase;
FT                   KEGG: gwc:GWCH70_0037 dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72894"
FT                   /db_xref="GOA:A0A0F6BHJ3"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ3"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ADP72894.1"
FT                   /translation="MNTNKDIATPGRTREILEKYGFSFKKSLGQNFLIDTNILRKIVDV
FT                   AGLSRETGAIEIGPGIGALTEQLARRAKKVVAFEIDQRLLPILEDTLSPYENVRIIHQD
FT                   VLKADIHRVIAEEFTDAADIMVVANLPYYVTTPIIMKLLTDNLPIRGIVVMLQKEVADR
FT                   ISAQPGTKDYGSLSIAIQYYTEAEKIMTVPRTVFIPQPNVDSAVIRLIKRKQPPVDVDD
FT                   ESFFFQVVRASFAQRRKTILNNLISNLPNGKARKEKIERILTENGIDPRRRGETLTMEE
FT                   FAALSNALREVMCI"
     atgaatacaa ataaagatat tgctacgccg ggacgtacgc gagaaatttt ggaaaagtac        60
     ggtttttcat tcaaaaaaag tttaggacaa aattttttga ttgacactaa tattttgcgg       120
     aaaattgtcg atgttgccgg actttcgcgc gaaacggggg cgattgaaat cggtcccgga       180
     atcggggcgt tgacggaaca gctggcgcgc cgcgcaaaga aggtcgtcgc gtttgaaatt       240
     gatcagcggc ttttgccgat tttggaggat acgttatcgc cgtatgaaaa cgtccgcatt       300
     atccatcaag atgttttaaa agcggatatt caccgcgtga tcgccgaaga atttaccgac       360
     gccgccgata ttatggtggt agcgaatttg ccgtattacg tcacaacgcc gattattatg       420
     aagctattga cagataactt gccgattcgc ggcattgtcg ttatgttgca aaaagaagtg       480
     gctgaccgca tctccgcgca gccgggaacg aaagattacg gttcgctgtc cattgcgatt       540
     cagtattaca cggaagcgga gaagatcatg accgttccaa gaacggtgtt tattccacag       600
     ccaaatgtgg attctgctgt gattcggtta ataaagcgga agcagccgcc tgttgacgta       660
     gacgatgaat cgtttttctt tcaagtggtg cgggcgagtt tcgcgcaacg ccggaaaacg       720
     attttgaaca atttaatcag caacttgccg aacggaaaag cgagaaaaga aaaaatcgag       780
     cgcattttaa cagagaacgg aattgacccg cgccgccgcg gagagacatt gacgatggaa       840
     gagtttgccg cgctcagcaa cgcgttaagg gaagtcatgt gcatataa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page