(data stored in ACNUC7421 zone)

EMBL: CP002293.PE380

CP002293.PE380       Location/Qualifiers
FT   CDS_pept        432879..434060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0395"
FT                   /product="histidyl-tRNA synthetase 2"
FT                   /EC_number="6.1.1.21"
FT                   /note="TIGRFAM: histidyl-tRNA synthetase 2; KEGG:
FT                   gwc:GWCH70_2981 histidyl-tRNA synthetase 2; PFAM: tRNA
FT                   synthetase class II (G H P and S)"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73236"
FT                   /db_xref="GOA:A0A0F6BII5"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII5"
FT                   /inference="protein motif:TFAM:TIGR00443"
FT                   /protein_id="ADP73236.1"
FT                   /translation="MTKKLFMFEKPLGMRDTLPFLYEIKKRVRQAMVREIETWGYELIE
FT                   TPTLEYYETVGAASAIDDHQLFKLLDQQGHTLVLRPDMTAPIARLAASRLYQDGNPLRL
FT                   AYNANVFRAQQREGGRPAEFEQIGVECIGDGTVAADAEVISVMIAALKQTGLRNFTVAI
FT                   GHIGYVNALFLEILGNEERASVLRRFLYEKNYVGYREHVKSLPLSSIDQKRLLQLLHLR
FT                   GNDKTMENARELVHSEEGKRAVDELCELASALQLYGVDGAVKIDMSLVSHMSYYTGILF
FT                   EVYAEHVGFPIGNGGRYDELLEKFSRKAPATGFGVRVDRLIEALGESEAEAAIECIVFS
FT                   QERFAEALELARTKRREGKRVVLQHILGIRDIDAYSKKYQPITYLLGSGGKEE"
     atgacgaaaa agttgtttat gtttgaaaaa cctctcggca tgcgcgatac tttgccgttt        60
     ttatatgaaa tcaaaaaacg tgttcgccag gcgatggtcc gtgaaatcga aacatggggg       120
     tatgaattga ttgaaacgcc gacattggaa tattacgaga cggtcggcgc cgcctcggcg       180
     attgacgacc atcagctgtt taagctgctc gaccagcaag gacatactct cgttcttcgt       240
     cccgatatga ccgccccgat tgcaaggctg gccgcttccc gcctttatca agacggcaat       300
     ccgctccgcc ttgcgtataa cgcgaatgtg ttccgcgccc agcagcgcga aggcgggcgt       360
     ccggcggaat ttgaacagat cggtgtcgaa tgcatcgggg acggcacggt tgcggccgat       420
     gcagaagtca ttagtgtcat gatcgcagcg cttaagcaaa ccgggctgcg gaatttcacg       480
     gtggcgatcg gccatatcgg ctatgtcaat gccctgtttt tagaaatttt aggaaatgaa       540
     gaacgtgcca gtgtattgcg ccgtttttta tacgaaaaaa attacgttgg ctatcgggaa       600
     catgtgaagt ctcttcctct ttcttctatt gatcaaaaac gcttgctcca attattgcat       660
     ttgcgcggca acgacaagac gatggaaaat gccagagagc ttgtccatag cgaggaagga       720
     aagcgtgcgg tcgacgagct ttgcgaactt gccagtgcgc ttcaactgta cggtgtggac       780
     ggcgcagtga aaattgatat gtcgctcgtc agccatatga gttattatac gggcatttta       840
     tttgaagtat atgccgaaca tgtcggcttc ccgatcggaa atggcgggcg ctatgacgag       900
     ctgctggaga aattttcacg gaaagccccg gcaaccgggt ttggcgttcg cgttgatcgg       960
     cttatcgaag cgctcgggga atcagaggcg gaggctgcga ttgagtgcat cgtgtttagc      1020
     caggagcggt tcgccgaagc gctggagctt gcgagaacga agcggcggga agggaagcgc      1080
     gtcgtgctcc agcatatttt aggcatccgc gatattgacg catacagcaa aaaataccag      1140
     ccgattacct atttgctcgg cagcggagga aaggaggagt ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page