(data stored in ACNUC7421 zone)

EMBL: CP002293.PE381

CP002293.PE381       Location/Qualifiers
FT   CDS_pept        434064..434684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0396"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="TIGRFAM: ATP phosphoribosyltransferase; KEGG:
FT                   gwc:GWCH70_2980 ATP phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73237"
FT                   /db_xref="GOA:A0A0F6BII6"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII6"
FT                   /inference="protein motif:TFAM:TIGR00070"
FT                   /protein_id="ADP73237.1"
FT                   /translation="MLTIAMPKGRIFAEALELLQKAGYTLPAEFAESRKLMMEVPEENM
FT                   RFILAKPMDVVTYVEHGVADLGIAGKDVMMEEERDVYELLDLKISKCHLAVAGLPNGRM
FT                   PQIAPRVATKYPNIASSYFREQGEQVEIIRLNGSIELAPLIGLADRIVDIVSTGRTLKE
FT                   NGLVELEKIADVTSRLIVNPVSYRIKDEEVDVLVCRLSEVIPQ"
     gtgctgacga ttgcgatgcc gaaagggcgg atttttgccg aagcgcttga attgctgcaa        60
     aaagcgggat atacgctccc ggcggaattc gctgaatcaa gaaagctgat gatggaagtg       120
     cctgaagaaa atatgcgctt tattctcgcc aagccgatgg atgtcgtcac atatgttgaa       180
     catggggtgg ccgatttggg catcgccggc aaagacgtga tgatggaaga agaacgtgat       240
     gtatatgagc tgttagattt aaagattagt aagtgccatt tagcggtggc gggcttgcca       300
     aacgggcgca tgccgcaaat tgcgccgcgc gtggcgacaa aatacccgaa catcgcttcg       360
     agctatttcc gcgaacaagg ggagcaagtc gaaattattc ggctgaacgg ttccatcgag       420
     ctcgctccgc ttatcgggct tgccgaccgc attgtcgata tcgtctcgac agggcggacg       480
     ctgaaagaaa acgggcttgt ggagctggag aaaattgctg acgtcacatc aagattaatc       540
     gttaatccgg tcagttaccg aatcaaagac gaagaagtgg acgtgttggt ctgccgtttg       600
     tccgaagtca ttccgcaatg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page