(data stored in ACNUC7421 zone)

EMBL: CP002293.PE382

CP002293.PE382       Location/Qualifiers
FT   CDS_pept        434700..435968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0397"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="TIGRFAM: histidinol dehydrogenase; KEGG:
FT                   gwc:GWCH70_2979 histidinol dehydrogenase; PFAM: Histidinol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73238"
FT                   /db_xref="GOA:A0A0F6BII7"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII7"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ADP73238.1"
FT                   /translation="MKIERVKSRVSLRRTIESGTEEQRRAVLEIISTVRARGDEALKSY
FT                   TEKFDGVRLDSLRVTNEEIEAAYQNVSEEALRIIREAAENIRDYHERQKRESWIIAKED
FT                   GTMLGQKITPLDAVGLYVPGGTAAYPSSVLMNVIPAQVAGVKRIVITSPPNKNGTLPAG
FT                   VLVAASELGVKEIYKVGGAQAIAALAYGTETIRPVDKIFGPGNIYVALAKREVFGQVAI
FT                   DMIAGPSEIVVLADETANVNEIAADLLSQAEHDERASAILVTPSMKLALAVASEVKKQL
FT                   ETLPRKAIAVSALENYGAIYVTETLAEAVEVVNELAPEHLEVMTAEPMQLLGQIRHAGA
FT                   IFLGRFSSEPVGDYFAGPNHVLPTNGTARFSSGLSVDEFVKKSSIIFYSEPALQRNAGK
FT                   IAAFARLEGLEAHARAVEERFKK"
     gtgaaaatcg aacgagtgaa aagccgtgta tcattgcgcc gcacgattga gtcagggacg        60
     gaagaacagc ggcgtgcggt gttggagatt atttccactg tgcgcgcccg cggcgatgaa       120
     gccttgaaaa gctatacgga aaaattcgat ggcgtgcggc tcgattcgct gcgcgtgaca       180
     aatgaagaaa tcgaagcggc gtatcaaaac gtaagcgagg aagcgcttcg catcattcgc       240
     gaagcggcgg aaaacattcg cgattatcac gagcggcaaa agagggagtc atggatcatt       300
     gcaaaagaag acggcacgat gctcgggcaa aaaataacgc cgctcgatgc ggttgggctg       360
     tacgttccag gagggacggc ggcatacccg tcatcggtgc ttatgaatgt cattcctgct       420
     caagtggcgg gagtgaaacg gatcgtgatc acatctccgc caaataaaaa cgggacgctc       480
     ccggccggcg tattagtcgc ggccagtgaa ttgggcgtga aagaaatcta taaagtcggc       540
     ggcgcgcagg cgattgccgc gctcgcatat ggaacggaaa cgattcgccc ggtcgataaa       600
     attttcggac caggcaacat ctatgtggcg cttgccaaac gggaagtgtt tggacaagtg       660
     gcgattgaca tgattgccgg gccaagcgaa atcgtcgtgc tggccgatga aacggcaaat       720
     gtgaacgaaa tcgccgctga cttgttgtca caagctgaac atgatgagcg tgcttcggcg       780
     attctcgtca cgccgtcgat gaaattggcg ctcgcggtcg caagcgaggt caaaaaacag       840
     cttgaaacgc tgccgcgcaa agcgattgcc gtttcggcgc tcgaaaatta cggagcgatt       900
     tatgttacag aaacgcttgc ggaagcggtg gaagttgtca atgaactggc gccagagcat       960
     ttggaagtga tgacagccga accgatgcag cttcttggcc aaatccgcca cgcgggagcg      1020
     atttttttag ggcgcttcag ctctgagcct gtcggcgatt atttcgccgg cccgaaccac      1080
     gtgctgccga cgaacggcac ggcccggttt tcgagcggat taagcgtgga tgagtttgtg      1140
     aaaaaatcga gcatcatttt ttacagtgaa ccggcgctac aacgaaacgc cggaaaaatc      1200
     gcggcattcg caagacttga agggcttgag gcacatgcgc gcgccgttga ggaacgtttc      1260
     aaaaaataa                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page