(data stored in ACNUC7421 zone)

EMBL: CP002293.PE385

CP002293.PE385       Location/Qualifiers
FT   CDS_pept        437207..437944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0400"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; KEGG: gwc:GWCH70_2976
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase; PFAM: histidine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73241"
FT                   /db_xref="GOA:A0A0F6BIJ0"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ0"
FT                   /inference="protein motif:TFAM:TIGR00007"
FT                   /protein_id="ADP73241.1"
FT                   /translation="MAAFTIYPAIDIRGGKCVRLLQGDYTKETVYGDSPVEMAALFAEQ
FT                   GAEWIHMVDLDGAKEGKRVNDRFVVEAAKQLPVKVQIGGGIRTEDDIVYYLENGVARVI
FT                   LGSAAIARPSFVKEMLKKYGERIAIGIDAKDGFVATEGWLHTSNVKATDLGKELAEAGA
FT                   QTFIFTDIATDGMLSGPNIQAAVEMARATGKDVIASGGVRSLADLVSLQNHVGDGVAGA
FT                   IVGKALYTKQFTVAEALKVVQGE"
     atggcggcgt ttacgattta tccagcgatt gatatacgcg gcggcaaatg tgtccgcctt        60
     ttgcaaggcg actatactaa agaaacggta tatggcgatt cgccggtcga aatggccgcc       120
     ttgttcgccg aacaaggggc ggaatggatt catatggtgg acttagacgg cgcgaaagaa       180
     ggaaaacgcg tcaacgaccg cttcgtcgtc gaagcggcga aacagctgcc ggtgaaagtg       240
     caaatcggcg gcggcattcg cacggaagat gatattgtct attatttgga aaacggcgtg       300
     gcccgcgtca ttttaggcag cgccgccatc gcccggcctt cgtttgtcaa ggaaatgctg       360
     aaaaaatatg gcgagcgcat tgcgatcggc attgatgcga aagacgggtt tgttgcgacg       420
     gaagggtggc ttcacacatc gaatgtcaaa gcgacagacc ttggaaaaga gctggcagaa       480
     gctggagcgc aaacattcat cttcacggat atcgcgacag acggaatgct gtctgggcca       540
     aatattcagg cagctgtcga aatggcgcgc gcaaccggaa aggatgtgat cgcttccggc       600
     ggcgtccgct cgcttgcaga tttagtatcg ctgcaaaacc acgtcggtga cggcgtcgcc       660
     ggcgcgatcg tcggcaaagc gctctacacg aagcaattta cggtggcgga agcgctgaag       720
     gtggtgcaag gggaatga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page