(data stored in ACNUC7421 zone)

EMBL: CP002293.PE39

CP002293.PE39        Location/Qualifiers
FT   CDS_pept        51349..52233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0039"
FT                   /product="sporulation peptidase YabG"
FT                   /note="KEGG: gwc:GWCH70_0038 sporulation peptidase YabG;
FT                   TIGRFAM: sporulation peptidase YabG; PFAM: peptidase U57
FT                   YabG"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72895"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ4"
FT                   /inference="protein motif:TFAM:TIGR02855"
FT                   /protein_id="ADP72895.1"
FT                   /translation="MDVKVGDIVARKSYNCDLLFRVIDVKEKNGEREAILHGENVRLIA
FT                   DAPCSDLVIIDEREQQERKKKEIELIEQSYKLFRQDYHAIKQKTEYRATGGYRTEKDFF
FT                   QIPGRVLHLDGDPLYLRKCLDLYERIGVPVYGIFCEESEMPEKVGVLLERFRPDILVIT
FT                   GHDSYSKSKGKVTDLKAYRHSKHFVQTVKEARKKVPHLDQLIIFAGACQSHFESLIRAG
FT                   ANFASSPARVNIHALDPVYIVSRISFTPFMETVNVWDVLRNTLTGEKGLGGVETKGVLR
FT                   TGMPFRLIDTMND"
     atggacgtta aggtcggcga tattgttgca aggaagtcgt ataattgtga tttactgttt        60
     cgtgtcatag atgtgaaaga aaaaaatggg gaaagagaag cgattttgca tggtgaaaat       120
     gtgagactta tcgccgatgc cccatgcagc gatttagtca ttattgatga acgagaacag       180
     caggaaagaa agaaaaagga aatagagctg atcgagcagt cgtataaact gtttcgccaa       240
     gattatcatg ccataaaaca aaaaacagag tatcgggcga cgggaggata ccggacggaa       300
     aaagattttt ttcaaattcc ggggcgcgtc cttcatttgg acggggaccc tttatatttg       360
     cggaagtgtt tggatttgta tgaacgaatt ggcgtgccgg tgtacggcat attttgcgag       420
     gaaagtgaaa tgcccgaaaa agtcggcgtg cttcttgagc gatttcgccc tgatatttta       480
     gtgattaccg gccatgattc ctattcgaaa tcgaaaggaa aagtgacgga tttaaaggca       540
     tatcgccatt ccaaacattt tgttcaaacg gtgaaagaag cgcgcaaaaa agttccgcat       600
     cttgaccaat tgatcatttt cgcgggagca tgccaatccc attttgaatc actgattcgc       660
     gctggtgcga attttgccag ttccccggcg cgcgttaaca ttcatgcgct tgatccagtt       720
     tatatcgttt cccgaataag ttttactcct ttcatggaaa cggtgaatgt ttgggatgtt       780
     cttcgcaata cattgaccgg agaaaaggga cttggagggg tggaaacgaa aggagtattg       840
     cgcacgggga tgccgttccg tttgattgat acgatgaacg attga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page