(data stored in SCRATCH zone)

EMBL: CP002293.PE390

CP002293.PE390       Location/Qualifiers
FT   CDS_pept        442194..442661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0405"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: gwc:GWCH70_2971 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73246"
FT                   /db_xref="GOA:A0A0F6BIJ5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ5"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADP73246.1"
FT                   /translation="MSVLQRVTNCVLVKDGKVLLLQKPKRGWWVAPGGKMEQGESVREA
FT                   CIREYREETGIYLKNPKLKGVFTIVVKNQEQTVSEWMMFTFFADQFAGENVPYCEEGKL
FT                   EWHPLETIHQLPMAPGDYHILDYALKGSGVMYGTFIYTEDFDLLSYRLDPS"
     gtgagcgtgt tgcagcgcgt gacaaattgc gttttagtaa aagatggaaa agtgttattg        60
     ttgcaaaagc cgaagcgggg ctggtgggtt gccccgggag gaaagatgga acaaggggaa       120
     tccgtccgcg aagcatgcat tcgcgaatat cgtgaagaga cgggaattta tttaaaaaac       180
     ccaaagctta aaggagtttt taccattgtt gtcaaaaatc aagagcaaac ggtttcggaa       240
     tggatgatgt ttaccttttt tgccgatcaa tttgctggcg aaaatgttcc gtactgtgaa       300
     gaaggaaaat tggaatggca tccgttggaa acgattcacc agcttccaat ggcgcctggt       360
     gattaccata ttttagatta tgcccttaaa ggatcaggcg ttatgtacgg aacgtttata       420
     tatacagaag atttcgatct gctttcttac cggttagatc ccagttga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page