(data stored in ACNUC7421 zone)

EMBL: CP002293.PE391

CP002293.PE391       Location/Qualifiers
FT   CDS_pept        442680..443573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73247"
FT                   /db_xref="GOA:A0A0F6BIJ6"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ6"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2970"
FT                   /protein_id="ADP73247.1"
FT                   /translation="MSEGSANNIQVVIITGMSGAGKTVAIQSFEDLGFFCVDNLPPTLL
FT                   PKFLELMKESGNKINKVALVMDLRSRDFFDSLFTALDDLAEQSWVTPQILFLDAEDSTL
FT                   VARYKETRRTHPLAPNGLPLEGIRLERKLLEELKGRAQIIYDTSDLKPRELREKILQQF
FT                   SSHAQQTFTVNVMSFGFKYGVPIDADLVFDVRFLPNPHYIDHMRPKTGLDEEVSSYVLK
FT                   WGETQKFLEKLIDLLTFMLPHYKREGKSQLVIAIGCTGGQHRSVAIAEYIARHFANDYK
FT                   THVSHRDMERRKEKHK"
     atgagcgaag gttcggccaa taatattcaa gtggtgatta tcacggggat gtctggcgcc        60
     gggaaaacgg tcgcgattca gagctttgaa gacttgggct ttttttgtgt cgataatttg       120
     ccgccgacgc tgcttccaaa atttttggag ctgatgaaag aatcggggaa taaaataaat       180
     aaagtggcgt tagtaatgga tttgcgaagc cgcgactttt tcgacagctt gtttaccgca       240
     ctggacgact tggcggagca atcatgggta acgccgcaaa ttttattttt ggacgccgaa       300
     gattcgacgc tggtagcgcg gtataaagaa acgagacgca cgcacccgct cgcgccaaac       360
     ggattgccgc ttgagggaat tcgtttggaa cgcaaattgc tcgaagaatt aaaaggaagg       420
     gcgcaaatta tttacgatac gtcggattta aaaccgcgcg agctgcggga aaaaattttg       480
     cagcagtttt cttcccatgc gcagcaaacg tttacggtca acgtcatgtc gtttggcttt       540
     aaatacggcg ttccgattga cgccgactta gtatttgatg ttcgcttttt gccaaaccct       600
     cactatattg accatatgcg cccgaaaaca ggtttggatg aggaagtttc atcctatgtg       660
     ctgaagtggg gggaaacgca aaaatttctc gaaaaactga tcgatttatt gacatttatg       720
     ctcccgcatt ataagcggga aggaaaaagc cagcttgtga ttgccattgg ctgcacggga       780
     gggcagcacc ggtcggtggc gattgccgaa tatatcgccc gccattttgc caacgattat       840
     aaaactcatg tgtcccaccg tgacatggag aggagaaagg aaaagcataa atga             894
//

If you have problems or comments...

PBIL Back to PBIL home page