(data stored in ACNUC7421 zone)

EMBL: CP002293.PE393

CP002293.PE393       Location/Qualifiers
FT   CDS_pept        444574..445536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0408"
FT                   /product="protein of unknown function DUF199"
FT                   /note="PFAM: protein of unknown function DUF199;
FT                   Sporulation regulator WhiA-like; KEGG: gwc:GWCH70_2968
FT                   protein of unknown function DUF199"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73249"
FT                   /db_xref="GOA:A0A0F6BIJ8"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ8"
FT                   /inference="protein motif:PFAM:PF02650"
FT                   /protein_id="ADP73249.1"
FT                   /translation="MSFASETKKELTNLEVKPCCLKAELSALLRMNGLLSFSNRKIIVD
FT                   VQTENAAIARRIYTLLKKGYEVTVELLVRKKMRLKKNNVYIVRIVDGAHELLKDLKILE
FT                   EDFSLIRVISPELVKKKCCKRSYLRGAFLAGGSVNNPETSSYHLEIFSLYEEHNDSLCE
FT                   LMNSHFFLNAKTLERKKGFITYLKEAEKISEFLNIIGAHQALLRFEDIRIVRDMRNSVN
FT                   RLVNCETANLNKTIGAALRQVENIRYIDETIGLSSLPDKLREIAELRMMYQDVTLKELG
FT                   ELVSGGKISKSGINHRLRKIDEIAERLRAGKPVDFHKSL"
     atgtcatttg cgtcagaaac gaaaaaggaa ttaacgaatt tagaagtgaa accttgttgc        60
     ttaaaagcgg aattgtccgc gcttctccgc atgaatggtt tattatcttt ttccaaccgg       120
     aaaattattg tcgatgtgca aacggaaaac gctgccatcg cgcggagaat ttacactctt       180
     ttaaagaaag ggtacgaagt tacggtcgaa ctgttagttc gaaaaaaaat gcgcctgaaa       240
     aaaaacaatg tgtacattgt gcgaatcgtc gacggcgctc acgaattgtt aaaggattta       300
     aaaatattgg aggaggattt ttcgctgatt cgggtcattt cgccagaatt agtgaaaaaa       360
     aagtgctgta agcgttctta tttgcgcggc gcgtttctcg ccggaggatc ggtaaacaat       420
     ccggaaacgt catcctacca tttagaaatt ttttctcttt atgaagaaca taacgactca       480
     ttatgtgaat taatgaacag ccattttttt cttaatgcta aaacgctgga acgaaaaaaa       540
     gggtttatta cgtatttaaa agaggcggaa aaaatttccg agtttttaaa cattattggc       600
     gcccatcaag cgttattgcg ctttgaagat atccgcattg tgcgcgatat gagaaattcg       660
     gtgaaccgcc ttgtcaattg cgaaacagcg aacttaaata aaacgattgg cgctgcgctt       720
     cgccaagtgg aaaatattcg ctatattgac gaaacgatcg gattgagctc ccttcctgat       780
     aaattgcggg aaattgcgga attgcggatg atgtatcagg atgtaacgtt aaaagaatta       840
     ggggaattag tatccggtgg gaagataagc aaatcaggaa tcaaccaccg tctgcggaaa       900
     attgatgaaa ttgcggaacg gttgcgggct ggcaagcctg ttgattttca taaatcatta       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page