(data stored in ACNUC7421 zone)

EMBL: CP002293.PE402

CP002293.PE402       Location/Qualifiers
FT   CDS_pept        452987..454525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0417"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /EC_number="5.4.2.-"
FT                   /note="TIGRFAM: phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; KEGG: gwc:GWCH70_2959
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: metalloenzyme
FT                   domain protein; BPG-independent PGAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73258"
FT                   /db_xref="GOA:A0A0F6BIK7"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIK7"
FT                   /inference="protein motif:TFAM:TIGR01307"
FT                   /protein_id="ADP73258.1"
FT                   /translation="MSKKPVALIILDGFALRDETYGNAIAQAKKPNFDRYWNEYPHSTL
FT                   TACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNIAIREGEFDRNETFLAAMNHV
FT                   KEKGTNLHIFGLLSDGGVHSHINHLYALLKLAAKEGVKNVYIHGFLDGRDVGPQTAPKY
FT                   IKELQEKIKEYGVGEIATLSGRYYSMDRDKRWERVEKAYRAMVYGEGPTYRDPLECIED
FT                   SYQHGIYDEFVLPSVIVREDGSPVATIKDEDAIIFYNFRPDRAIQISNTFTNEDFREFD
FT                   RGPKHPKNLFFVCLTHFSETVKGYVAFKPTNLDNTIGEVLSQHGLRQLRIAETEKYPHV
FT                   TYFMNGGREEKFPGEDRILINSPKVATYDLKPEMSAYEVTDALLKEIEADKYDAIILNY
FT                   ANPDMVGHSGKLEPTIKAIEAVDECLGKVVDAILAKGGIAIITADHGNADEVLTPDGKP
FT                   QTAHTTNPVPVIVTKKGIELRKGGILGDLAPTMLDLLGLPQPKEMTGKTLIIKK"
     atgagtaaaa aaccagtagc gttgattatt ttagacggat ttgcgctgcg tgatgaaacg        60
     tacggcaatg cgatcgcgca agcaaaaaag ccgaactttg accgttattg gaatgaatat       120
     ccgcattcaa cattaactgc atgcggtgaa gcggtcgggc ttccagaagg acaaatgggc       180
     aactcggaag tcggccactt aaatatcggt gccggccgca ttgtatacca aagcttaacg       240
     cgcgttaaca ttgcgattcg cgagggagag tttgaccgca acgaaacgtt tttagcggcg       300
     atgaatcatg tcaaagaaaa aggaacgaat ttgcacattt tcggcctgct ctccgatggc       360
     ggcgtgcaca gccacattaa ccatctgtat gcactgttaa aattggccgc aaaagaaggc       420
     gtaaaaaacg tctatatcca cggcttttta gatggccgtg acgtcggtcc acaaacggcg       480
     ccgaaatata ttaaagaatt acaagaaaaa ataaaagagt atggcgtcgg ggaaatcgcg       540
     acattatccg gccgttatta ctcgatggac cgcgacaaac ggtgggagcg cgttgaaaaa       600
     gcgtaccgcg cgatggtgta tggggaaggc ccaacctacc gcgatccgct tgagtgcatt       660
     gaagattctt atcaacatgg catttatgat gaattcgtgc ttccatcggt catcgtgcgt       720
     gaagacggat cgccggtggc gacgattaaa gacgaagatg cgatcatttt ctacaacttc       780
     cgtccagacc gggcgattca aatttcgaac acgtttacga acgaagactt ccgcgagttc       840
     gaccgtggtc cgaaacatcc gaaaaacttg ttctttgtct gcctgacaca ctttagtgaa       900
     acggttaaag gatatgttgc gttcaaaccg acaaatctgg ataatacgat cggggaagtc       960
     ctatcgcaac atggattgcg acagcttcgc atcgcggaaa cggaaaaata cccgcatgtg      1020
     acgtacttta tgaacggcgg gcgggaagag aagtttcctg gcgaagaccg cattttaatc      1080
     aattcgccaa aagtcgccac atacgactta aaaccagaaa tgagcgctta cgaagtaacc      1140
     gatgcgcttc ttaaagaaat cgaagcagat aaatatgacg cgatcatttt aaactatgcg      1200
     aacccggaca tggtcggcca ctcaggaaaa ttagaaccga cgattaaagc gatcgaagcg      1260
     gtggatgagt gccttggcaa agtcgtggat gcgattcttg caaaaggcgg catcgccatt      1320
     attaccgcgg accatggaaa tgcggatgaa gtattgacgc cggatggcaa accgcaaacg      1380
     gcgcatacga caaatccggt tccggtgatc gtaacgaaaa aaggcatcga actccgcaaa      1440
     ggcggaattt taggtgattt agcgccaacc atgcttgact tgcttggctt gccacagcca      1500
     aaagaaatga caggaaaaac attaataata aaaaaataa                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page