(data stored in ACNUC7421 zone)

EMBL: CP002293.PE404

CP002293.PE404       Location/Qualifiers
FT   CDS_pept        457101..457334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0420"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="KEGG: gwc:GWCH70_2957 preprotein translocase, SecG
FT                   subunit; TIGRFAM: preprotein translocase, SecG subunit;
FT                   PFAM: Preprotein translocase SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73260"
FT                   /db_xref="GOA:A0A0F6BIK9"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIK9"
FT                   /inference="protein motif:TFAM:TIGR00810"
FT                   /protein_id="ADP73260.1"
FT                   /translation="MHTLLVTLLVIVSIALIVVVLLQSGRSAGLSGAITGGAEQLFGKQ
FT                   KARGLDAVLQRITVVLAVLFFVLSIAVTYMQL"
     atgcatacgt tgcttgtcac attgttagtt attgtttcga ttgcgcttat tgtggtcgtt        60
     ttgttgcaat cgggacgaag cgctggcctt tctggcgcca ttaccggcgg tgcggagcag       120
     ctgtttggaa aacagaaagc gcgcggattg gatgcggtgt tgcagcgcat aacagttgtg       180
     ctagcggtat tgttttttgt attatcaata gcggtgacgt atatgcaact ttaa             234
//

If you have problems or comments...

PBIL Back to PBIL home page