(data stored in SCRATCH zone)

EMBL: CP002293.PE407

CP002293.PE407       Location/Qualifiers
FT   CDS_pept        460556..461023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0423"
FT                   /product="SsrA-binding protein"
FT                   /note="KEGG: gwc:GWCH70_2954 SsrA-binding protein; TIGRFAM:
FT                   SsrA-binding protein; PFAM: SmpB protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73263"
FT                   /db_xref="GOA:A0A0F6BIL2"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL2"
FT                   /inference="protein motif:TFAM:TIGR00086"
FT                   /protein_id="ADP73263.1"
FT                   /translation="MPKGEGKLIAQNKKAHHDYFIEETYEAGIVLKGTEIKSIRAGKVN
FT                   LKDSFAKVEKGEVFLHNMHISPYEQGNRYNHDPLRTRKLLLHRREINKLIGYTKEQGYT
FT                   LVPIKLYIKNGFAKVLLGVGKGKKKYDKREDMKRKEAQREIERAFRERQKI"
     atgccgaaag gtgaagggaa actgatagct caaaacaaaa aagcgcatca cgattatttt        60
     atcgaagaaa cgtatgaagc agggatagtc ttaaaaggaa cggaaattaa atcgattcgt       120
     gccggaaaag taaatttaaa ggattcgttt gcgaaagttg aaaaaggaga agtatttctt       180
     cataatatgc atatcagccc gtatgaacaa gggaaccgct acaaccatga cccattgcgg       240
     acaagaaagc tccttcttca tcgccgggaa attaataagc tgattggcta cacaaaggaa       300
     caaggttata cgctcgtgcc gataaagctg tatattaaaa acggttttgc caaagtgttg       360
     ctgggagtcg gcaaagggaa gaaaaaatat gataagcgcg aagatatgaa acgaaaagaa       420
     gcacaacggg aaattgaacg tgctttccgc gagcggcaaa aaatatga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page