(data stored in ACNUC7421 zone)

EMBL: CP002293.PE408

CP002293.PE408       Location/Qualifiers
FT   CDS_pept        462021..463310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0424"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="KEGG: hmo:HM1_2081 signal transduction protein,
FT                   putative; PFAM: EAL domain protein; SMART: EAL domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73264"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL3"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADP73264.1"
FT                   /translation="MADQLASIMLLADSLNSENLTAKIDKYLNKHPVGLIYLDIKRFRE
FT                   IEKRHGPIACQKLLEVWKQLIFEAEMSDSFGLLTHRMFGDDVLLFVRAERGDANWAKMG
FT                   LLRLAHEISTMFGKKLNESIALSGDSIELYAGTAVLDPSTGRTAESLLYDAIKEAIHEA
FT                   RSKTDAEFRHLQMEFRDILARRKIAAHYQPIISLSTGSIYGYEALARGPQASYFATPNR
FT                   LWEFAEKENQLYALETAARQRAIEGFLPHDSNWKLFINLNANVIHDPQFTPGQTLAFLE
FT                   KMNLTPQNVVFEITERQSIDDYASFTKALDHYRNQGYQIAIDDAGAGYSSLQAIAELRP
FT                   DYIKIDRSIIHHIGCDKIKEILLETLAGFAQKINCQIIAEGIETFEELEIVRRLGVHFG
FT                   QGYLLGRPCPQLQPVPDAVLKWIQRYSSTV"
     atggcggatc agcttgcttc cattatgttg ctcgccgaca gcctgaatag cgaaaatctt        60
     acggcgaaaa tagataaata tttaaacaaa catcctgtag ggcttattta tttagatata       120
     aaacgtttta gggaaataga aaaaagacat gggccaatag cgtgccaaaa gctgcttgaa       180
     gtatggaaac aattgatttt cgaagcggaa atgtccgact cattcggttt gttgacccac       240
     cgaatgtttg gcgatgatgt tttgttgttt gtccgtgcgg agcggggaga tgcaaattgg       300
     gcgaaaatgg gtttgcttcg cttggcgcat gagattagca ccatgtttgg aaagaaatta       360
     aatgaatcaa tcgcattgtc tggcgattcg attgaacttt atgctgggac ggcggtgttg       420
     gatcctagca caggaagaac agccgaaagc ttgctgtatg atgcgatcaa agaagcaatt       480
     cacgaagcga gaagcaaaac ggacgcggaa ttcagacact tgcagatgga atttcgtgat       540
     atacttgcaa ggcgtaagat agcggctcat tatcaaccga ttatctctct ttcaactggg       600
     agcatctatg gatatgaagc gctagcgcgc ggtccgcagg cgagttattt tgcgacgccg       660
     aatcgcctgt gggaatttgc ggaaaaagaa aatcagctgt atgcattgga aacagccgcc       720
     cgtcagcggg caattgaggg atttttgcca cacgattcga actggaaatt attcatcaat       780
     cttaatgcca atgtgattca cgatccacag tttacccctg gacagacatt ggccttcctc       840
     gaaaagatga atttgacacc acaaaacgtt gtgtttgaaa ttacagagcg ccagtccatc       900
     gatgattacg cgtctttcac gaaagcgtta gatcattatc ggaaccaggg ataccaaatt       960
     gcaattgacg atgccggagc gggctattct tctttgcaag caattgctga attgcgcccc      1020
     gattacatta aaattgaccg ttcgattatt catcatatcg gctgcgacaa gattaaagaa      1080
     attttgttgg agacgctggc aggatttgcg cagaaaatca attgccaaat tattgcagaa      1140
     ggaatcgaga cttttgagga gttggaaata gtaagacggc ttggcgttca tttcggccaa      1200
     ggatatttgt taggcagacc atgtccgcag ctacagccgg ttccggatgc ggtgctgaaa      1260
     tggattcaaa gatattcttc aacagtttga                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page