(data stored in ACNUC7421 zone)

EMBL: CP002293.PE409

CP002293.PE409       Location/Qualifiers
FT   CDS_pept        463680..464243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0425"
FT                   /product="3D domain-containing protein"
FT                   /note="KEGG: hypothetical protein; PFAM: 3D
FT                   domain-containing protein; Peptidoglycan-binding lysin
FT                   domain; SMART: Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73265"
FT                   /db_xref="GOA:A0A0F6BIL4"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL4"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADP73265.1"
FT                   /translation="MKKLLLSITSSFFLAFGFSGAASAAGTYQVKSGDTLWNIAKKHKV
FT                   TVSQLKSWNNLKSDLIKPKQVLKILGTTTKAAAKTTVKKEAAKTAAYKTITVKAYAYTV
FT                   NCKGCSGITATGLNLKKNPSLKVIAVDPKVIPLGSKVYVEGYGYAVAADKGGGIRGNKI
FT                   DVFMPTKAKAIQWGVRTVKVKVYK"
     ttgaaaaaat tactattatc tattacttca tcattctttc tagcatttgg attttcagga        60
     gctgcatcgg cagccggtac atatcaggta aaaagtggtg acactctttg gaatatagct       120
     aaaaagcata aagtgactgt cagccagctt aagagctgga ataaccttaa aagcgatttg       180
     atcaaaccaa agcaggtttt aaagatttta ggaacgacaa ccaaagcggc tgctaaaaca       240
     acagtaaaaa aggaggcagc caaaacagca gcgtacaaaa caatcaccgt taaagcatat       300
     gcttatacag taaactgcaa agggtgcagc gggataacgg ctacaggctt aaatttaaag       360
     aaaaatcctt cgctgaaagt tattgccgtt gatccaaagg taattccgtt aggctcaaag       420
     gtttatgtgg aaggttacgg ctatgcggtt gcagctgata aaggaggcgg aatcagaggc       480
     aacaaaattg acgtattcat gccaacaaaa gcaaaagcta tccaatgggg tgtgagaaca       540
     gtaaaagtta aagtatataa ataa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page