(data stored in ACNUC7421 zone)

EMBL: CP002293.PE41

CP002293.PE41        Location/Qualifiers
FT   CDS_pept        52810..52962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0041"
FT                   /product="small acid-soluble spore protein,
FT                   minoralpha/beta-type SASP"
FT                   /note="manually curated; KEGG: gwc:GWCH70_0040 small
FT                   acid-soluble spore protein, minoralpha/beta-type SASP"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72897"
FT                   /db_xref="GOA:A0A0F6BHJ6"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ6"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0040"
FT                   /protein_id="ADP72897.1"
FT                   /translation="MSQRFKEELAKELGFYDVVQKEGWGAIRAKDAGNMVKLAIEMAER
FT                   QLLKR"
     atgtcgcaac gctttaaaga agagttagca aaggaattgg gcttttatga tgtcgttcaa        60
     aaagaaggat ggggagcgat ccgcgcgaaa gacgctggaa atatggtgaa attggcgatc       120
     gaaatggctg aacgacagct gttgaaaaga taa                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page