(data stored in ACNUC7421 zone)

EMBL: CP002293.PE411

CP002293.PE411       Location/Qualifiers
FT   CDS_pept        464680..465297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0427"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73267"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL6"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0411"
FT                   /protein_id="ADP73267.1"
FT                   /translation="MLLALILIGGCEMDSKAQPEKLPDTVAFQDEFTREFMVSPKEVKE
FT                   GYYLFKSKTGGFTMLYPKNAKIDRMFYEKHKKYYESIHLGGGRERENISNYIRMTYENA
FT                   KITENIDVNLDLLSTYVHYNGKYTKFESNNNMIYFGKNEQHISNNDIIYYFFSYVKSKH
FT                   SHQAVRFIYAVTCKDAKQKCSIDVKKEEERAKMFMKSIKFQY"
     ttgctattgg cgttaatatt gatcgggggg tgtgagatgg attcgaaagc tcaaccggag        60
     aaattgccgg atacggtagc atttcaagac gagtttaccc gggaatttat ggtctcgcca       120
     aaagaagtga aggaggggta ttacttattt aagtcgaaaa ccggtggatt tacgatgttg       180
     tatccgaaaa atgcaaagat agatcgcatg ttttatgaaa agcataaaaa atattatgaa       240
     tctatacatt tgggtggggg gagagaaaga gaaaatatat ctaactatat cagaatgaca       300
     tatgaaaatg caaaaataac ggaaaacatt gatgtaaacc ttgatttatt atctacctat       360
     gtccactata atggcaaata tacaaaattt gaatctaata acaacatgat ttattttggt       420
     aagaatgaac aacatatttc caataatgat attatttatt attttttcag ttatgtaaag       480
     tcgaaacaca gccatcaagc agttcgattt atatatgcag tcacttgtaa ggacgcaaaa       540
     cagaagtgta gcatagatgt aaaaaaagaa gaagaacgag caaaaatgtt tatgaaatcg       600
     attaaatttc agtattga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page