(data stored in SCRATCH zone)

EMBL: CP002293.PE412

CP002293.PE412       Location/Qualifiers
FT   CDS_pept        465297..467264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73268"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL7"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0414"
FT                   /protein_id="ADP73268.1"
FT                   /translation="MEGAEEFVSNEEVLNTDILRARIMNVEYQNLTISEIKREIRRIYI
FT                   EETGKEPPANITIYRSDDFKNLNDIDSGFDGTVIHFYDEEKGINQSYTITRGSEAPEKD
FT                   TWKPLDWTYNVFGIFVGQNRSQYDAALRFDQIVTQKINEKIGRSDNKIKLKKIGLGHSL
FT                   GGNLNETIQLTEKRYEKVYVINDAPPSFYQLATIDEYFWGQLVKKFNLNFDHYEEIYSI
FT                   PPSKLKSFAEEYYKKQIDERSIYHLTAEEDLLYAVSGVRGFIDIGSRQFIDTNKGFTSI
FT                   KDLIAKISDKDVRAIQLYLSQYSDVYNEKGFDGVVQAMTGGDIAFIESLQGYDSMDYVW
FT                   HAGDIVSKANHMLDDMKVKIPELMKNVAILYKNLDPIFSVFVELGYVTPEEKKTVLSEV
FT                   KGIEKDVASIQQLLRKTWNWRMAIPFLTPLVTDDILQWKASIEVLFQIRDKVLDILKRL
FT                   QIIQENTKNLQNAITISVNAHSLNDVIMALARSKGRTYDKYGNLILIKKVGDHEIRMNL
FT                   SSAVRIYQKGLQILEEKETVLHEMKQRYFDEYVEDFEMQKRKLLNKINDMEQNPWAYQH
FT                   LLGHFTYDAEQVHVLRRIDVHESIPPLDPMIPHIFETMFSYYEQEISKGKELIATIKKS
FT                   FEEFFEQDQNVSKIFDLRYG"
     atggaggggg cggaagagtt tgtgtcaaat gaagaagtgc taaatacgga tatattgcgt        60
     gcgcggatta tgaatgtaga atatcaaaat cttaccatta gtgaaatcaa aagagaaatc       120
     agaagaattt atatcgaaga gacgggaaaa gagccacctg caaatatcac catttaccgt       180
     tctgatgatt ttaagaattt aaacgatatc gattcaggtt ttgatggcac agtgattcat       240
     ttttatgacg aggaaaaggg aatcaatcaa tcatatacca ttacaagggg aagcgaagcg       300
     ccggaaaaag atacttggaa gccccttgat tggacttaca atgttttcgg gattttcgtt       360
     ggacaaaata ggagtcaata cgatgctgca ttgcgatttg accagattgt gacacagaaa       420
     attaatgaaa aaattggacg tagtgataac aaaatcaaac taaagaaaat cggactggga       480
     cattcattgg gcgggaactt aaacgagaca atacaactca ctgaaaagag atatgaaaaa       540
     gtatatgtta ttaacgatgc accgcccagt ttttatcaac tagcaactat tgatgaatac       600
     ttctggggcc aattagtaaa aaaattcaat ttaaattttg atcattatga agagatttac       660
     tccatccccc cttccaagct taaatccttt gcggaagaat actacaaaaa gcaaatcgac       720
     gagcgttcga tttatcatct gaccgccgaa gaggatctat tgtatgcggt gagcggggtg       780
     cgggggttca tcgatatcgg aagccgccag ttcattgata cgaacaaggg ttttactagt       840
     atcaaagatt tgattgcaaa aatatcggat aaagatgtta gggccattca attgtattta       900
     tcgcaatatt ccgatgttta caacgaaaaa gggtttgatg gggtcgttca ggcgatgacg       960
     gggggcgata tcgcttttat tgagtcgctt cagggctatg atagcatgga ctacgtgtgg      1020
     catgcaggag acattgtctc gaaagcgaat catatgctcg acgatatgaa agtgaaaatt      1080
     ccggaactta tgaagaacgt ggcgattttg tataaaaatt tggatccgat attcagtgtt      1140
     tttgtggagt tgggctatgt tactccagaa gaaaagaaaa cggttttgag cgaagtcaag      1200
     ggaattgaaa aggatgtcgc atcgattcaa caactgcttc gcaaaacatg gaattggaga      1260
     atggccattc cattccttac cccattggta actgatgaca ttcttcaatg gaaagctagt      1320
     attgaggtgt tattccagat tcgggataag gtattggaca tcttaaaacg ccttcaaatc      1380
     atccaagaaa atacgaagaa tcttcaaaat gccatcacta taagcgtgaa tgcccattcc      1440
     ttgaacgatg tcatcatggc cctcgcccgt tccaaaggca gaacgtatga taagtatgga      1500
     aatttaatct taatcaagaa agtgggagac cacgaaatcc ggatgaatct ttcctccgcc      1560
     gtaagaattt atcaaaaagg actgcaaatc ttggaagaaa aagaaacggt attacatgag      1620
     atgaagcagc gatatttcga tgaatatgta gaagattttg aaatgcaaaa acgaaaactg      1680
     ctgaacaaaa tcaatgacat ggaacaaaat ccgtgggcct accagcattt attagggcat      1740
     ttcacctacg atgctgaaca agtgcatgtg ttacgccgca ttgatgtcca tgagtctatt      1800
     ccgccgttgg atccgatgat cccgcatatc tttgaaacga tgttttcata ttatgaacag      1860
     gaaatttcta aaggaaaaga acttattgca acgatcaaaa aatcgtttga agagtttttt      1920
     gagcaggacc aaaatgtgtc caagatattt gatttgcgat atggataa                   1968
//

If you have problems or comments...

PBIL Back to PBIL home page