(data stored in SCRATCH zone)

EMBL: CP002293.PE413

CP002293.PE413       Location/Qualifiers
FT   CDS_pept        467280..467612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0429"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL8"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0415"
FT                   /protein_id="ADP73269.1"
FT                   /translation="MGQLNMFYHFDVEQDFMYKANTFIQQLNRMSELDAELVHLIHQEM
FT                   KYGRGQIIDKTNEAVEQYQKRNLLSNDLYKNSMNTAAQRYTNMINDMRGQHITLYYDVI
FT                   IREKKR"
     atgggacaat tgaatatgtt ctatcatttt gatgtagaac aggatttcat gtataaagcg        60
     aacacgttta ttcaacaatt aaatagaatg agtgaattgg atgcggaatt ggttcatttg       120
     attcatcagg aaatgaaata tggaaggggg caaatcatcg acaaaaccaa tgaagcggtt       180
     gagcagtatc aaaaaaggaa tctattatcc aatgatctgt ataaaaactc aatgaatact       240
     gccgctcagc gatatacaaa catgattaat gatatgaggg gacaacatat cactttgtat       300
     tatgatgtca tcattcggga aaagaaaagg taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page