(data stored in ACNUC7421 zone)

EMBL: CP002293.PE415

CP002293.PE415       Location/Qualifiers
FT   CDS_pept        469173..469466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73271"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIM0"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0416"
FT                   /protein_id="ADP73271.1"
FT                   /translation="MSGVIRLTPEELRGVARQYNTESSNVTELISRLDQMSNVLQGIWE
FT                   GASSEAFIQQYHELRPSFEKMAVLLNEIAQQLHNSATILEETDQQIASQIRG"
     atgtcgggag tgattcgcct aacaccggaa gagttgcgcg gagtcgcaag acaatataat        60
     acggaaagct ctaatgtcac ggaattaatt tcaagactgg atcaaatgag caatgtgctg       120
     caaggaattt gggaaggtgc ttccagcgaa gcatttatcc agcagtatca cgagttgcgc       180
     ccatcatttg aaaaaatggc tgtactattg aatgaaatcg cgcaacaatt gcacaattcc       240
     gctacgattc tggaagaaac agatcagcaa atcgccagcc aaatccgtgg ataa             294
//

If you have problems or comments...

PBIL Back to PBIL home page