(data stored in ACNUC7421 zone)

EMBL: CP002293.PE416

CP002293.PE416       Location/Qualifiers
FT   CDS_pept        469546..469785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0432"
FT                   /product="protein of unknown function ubiquitin-like YukD"
FT                   /note="PFAM: protein of unknown function ubiquitin-like
FT                   YukD; KEGG: gtn:GTNG_0417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73272"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIM1"
FT                   /inference="protein motif:PFAM:PF08817"
FT                   /protein_id="ADP73272.1"
FT                   /translation="MYIQVTIDLRHYTEDVFDLRLSNFYSIKKLIDIVWQLKSISAPPR
FT                   EGYWVRVDNKQMVCPGYFTLKDSGITDGDRIVIL"
     atgtatattc aagtgaccat cgatcttcgg cattatacag aggatgtatt tgaccttcgc        60
     ctgtccaatt tttattcgat caaaaagctc attgatatcg tttggcagtt aaaaagcata       120
     tcggcaccgc caagagaagg ctactgggtg cgggtggaca ataaacaaat ggtctgcccg       180
     ggctatttta cattaaagga cagcggaatt accgatggag accgcattgt gatattgtag       240
//

If you have problems or comments...

PBIL Back to PBIL home page