(data stored in ACNUC7421 zone)

EMBL: CP002293.PE419

CP002293.PE419       Location/Qualifiers
FT   CDS_pept        475662..478448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73275"
FT                   /db_xref="GOA:A0A0F6BIM4"
FT                   /db_xref="InterPro:IPR023838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIM4"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0420"
FT                   /protein_id="ADP73275.1"
FT                   /translation="MTEKWKIVKLIAKIVFIVALPVLFFTFIGHNPMKVTERTTNRIAV
FT                   VNEDVGADYNKKTYEFGKEIVPALDDDSDYQWSVVNRSQAEKGLADGQYDAVVYLPSDF
FT                   SRNILTFNEKKPLKATIQYKIQPNLEAKNREQVQRELEAAKNTINQKMSTLYWSYVGQA
FT                   VEDIRKKFSAILEKEIAFQKTMYDFYTPSSAKLTKEIESQKKMLEQLLSSSKNAESSSN
FT                   DTLKGLEQAEAEIASFIEDIQMYKEYQQRQHDIIQQGIRQYETMISGGLRSVVERPWNV
FT                   RPELELSSQTLLQSVSKLRNMVTDSHTALTSLYNQLENSNVYERLLESQKDLIRQYQQQ
FT                   TDAKILDEVQQKLIPLRQRLQSATAPSAPNEQPGPGELPQPSGNGQWLDRLEQQLASLK
FT                   TELRTAKPQLPQETKEGQDASGSWGDIDNAINQLEVEMQKAKEAWQKQLAFEQQWQEKY
FT                   AQLAKQLAALANNDSGQSEETVVQQIVEKEQAILQSPSLSEERKQQLSAQFQPAIQSRN
FT                   MNDLLAYFYWLSVFEDTLKRMENFDEALVDQLILNWKEKADIFQTLLNIHSGIYQLQDG
FT                   SATSLHGAEAVENNVHSFVEVTFEYDKNVKKMQAELMGQLQSLNDAANEVTAQLQQTMD
FT                   EEGTIQSTVGADNGEFVIAIQQNTLQDITQISDLVTSIAEGQDRIIDYTNEMHEKVASV
FT                   QGRADELNNKWATNVNTTKQIKNDVYRLLDNTMVDKQTNGYVYDYLTNPVQVSGDIPKE
FT                   KATYTPPVVMLVIVLLCGMLIGFFLHYYSSVPLMLQLALLIIMNLLVGFIISTYGLRIY
FT                   PMQEVQALKWSIFTIILLFFCSAIVRLAFFIGPFTGWVLGVGLILFFITPLLDLVLPNF
FT                   RFDHPISETYMSIQYGDQQAFYPAVITLGVVTVLMSAVPFLKQRLDALQKEAETYEG"
     atgacggaaa aatggaaaat cgtcaagttg attgcgaaaa ttgtgtttat tgttgctctt        60
     cctgtcctgt tctttacgtt cattggccat aacccgatga aggtaacaga acggacgacg       120
     aaccgaatcg cggtagttaa tgaagatgta ggagctgatt ataataaaaa aacatacgaa       180
     ttcggcaaag aaattgtacc agctcttgat gacgattctg attatcagtg gtctgtcgtc       240
     aatcgcagcc aagcggaaaa agggctggcg gacggccaat atgacgctgt tgtgtatttg       300
     ccatccgatt tttcgagaaa cattttgacc tttaatgaga aaaagccgct taaggcaacc       360
     atccaatata aaatccagcc aaatcttgag gcgaaaaatc gggagcaggt acagagagaa       420
     ctagaagcgg cgaaaaatac gatcaaccaa aaaatgtcta cgctgtattg gagttatgtc       480
     ggccaagcgg tagaagatat tcgcaaaaaa tttagcgcta ttttggaaaa agaaatcgct       540
     tttcaaaaga cgatgtacga tttttacact cccagctctg ccaaattaac aaaagagatc       600
     gagagccaaa agaagatgct tgaacaactg ctttcatctt cgaaaaatgc cgaaagctcc       660
     tccaatgaca cgttgaaagg tttggagcag gcggaagcag aaattgcttc gtttatcgaa       720
     gatattcaga tgtataaaga gtatcagcaa cggcagcatg acatcattca acaaggaatt       780
     cggcagtatg aaacgatgat aagcggggga ttgcgttccg tcgtagaacg gccatggaat       840
     gtcagaccag agttggaatt aagcagccaa accttgctgc aatctgtgtc taaattgcgc       900
     aatatggtta cggacagcca tacggcgctg acaagtctct ataaccagct ggaaaattca       960
     aatgtttatg aacggctctt ggagtcgcaa aaagacctca tccgtcaata tcagcaacaa      1020
     acagatgcaa agatattgga cgaagtgcag caaaaactta ttccgctccg tcagcggctg      1080
     caatctgcca ccgctccgtc agcaccgaat gaacagccgg ggccgggaga gctgccacag      1140
     ccatcaggga acgggcagtg gctggatagg ctcgagcagc agctggcatc tttaaagacc      1200
     gagttgcgaa cggcgaaacc gcaactcccg caagagacga aggaagggca agatgcatcg      1260
     ggaagctggg gggatattga caatgccata aatcaactgg aagtggaaat gcaaaaagca      1320
     aaagaagcat ggcaaaagca gttagccttc gagcagcaat ggcaagaaaa atacgcgcaa      1380
     ttggcaaaac agttggccgc gctagcgaat aatgacagcg gacaatcgga agaaacagtg      1440
     gtgcaacaaa ttgtcgaaaa agaacaagcg attcttcagt ctccgtcgtt atccgaagag      1500
     cgaaaacaac aattatcagc acaatttcag ccggctattc aaagcagaaa catgaatgat      1560
     ctcctcgcat atttctattg gttatcggtt tttgaagata cgttaaagcg aatggagaat      1620
     tttgatgaag cacttgtgga tcagctgatt ttaaattgga aggaaaaagc agatattttc      1680
     caaactttat tgaatattca tagcggaatt tatcagctgc aggatggctc ggccacttct      1740
     ttgcacggcg cagaagcggt cgaaaacaac gtccattctt ttgtggaagt aacattcgag      1800
     tatgataaaa atgtgaaaaa aatgcaagca gagctgatgg gacaattgca atcactaaac      1860
     gatgccgcga atgaagtaac ggcacagctc cagcaaacca tggatgaaga aggaaccata      1920
     caatcaacgg tgggagccga caatggtgaa tttgttattg ccatccagca aaatacgctg      1980
     caagatatca cacaaatttc tgatttagtc acttccattg ccgaagggca agaccggatt      2040
     atcgattaca ccaatgagat gcatgaaaaa gtggcatcgg tccaaggacg ggcggatgag      2100
     ttaaacaaca aatgggcaac taatgtcaat acaaccaaac aaattaaaaa cgatgtttat      2160
     cgtctgttag acaatacgat ggttgacaaa caaaccaacg gatatgtgta tgattattta      2220
     accaatccgg tacaagtaag cggagatatt ccgaaagaga aagcaacgta cacgccgcct      2280
     gtcgtgatgc ttgtcattgt tttgctctgc ggcatgctca tcgggttttt cctgcattat      2340
     tattcttccg tgccgcttat gctgcagctg gcattgctga tcataatgaa cttgcttgtt      2400
     ggtttcatca tcagcacata tggattgcga atttatccga tgcaagaggt gcaggcgctt      2460
     aaatggagca tttttaccat tatcttatta tttttctgtt ccgccattgt tcgcttggcc      2520
     tttttcatcg gaccgtttac cggctgggtg ctcggagtcg gcttaatcct gtttttcatt      2580
     actccattac tcgacttagt attgcctaac tttcgctttg atcatccgat atcagaaaca      2640
     tatatgtcga ttcaatatgg agaccagcaa gcattttatc cagctgtcat tacgttagga      2700
     gttgttaccg tgcttatgtc cgctgttccg tttttgaagc agcgcctgga cgctctgcag      2760
     aaggaggcgg aaacatatga agggtag                                          2787
//

If you have problems or comments...

PBIL Back to PBIL home page