(data stored in ACNUC7421 zone)

EMBL: CP002293.PE420

CP002293.PE420       Location/Qualifiers
FT   CDS_pept        478438..478929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73276"
FT                   /db_xref="GOA:A0A0F6BIM5"
FT                   /db_xref="InterPro:IPR018920"
FT                   /db_xref="InterPro:IPR020212"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIM5"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0421"
FT                   /protein_id="ADP73276.1"
FT                   /translation="MKGRRRLMMFCFPFLCSVLAAMGMTVYAESDEWPEIEPNQYQRQD
FT                   IELRTDYLHEESLLDEKRDLPEVQTSLTFQRPASSFFERTKAQLFLSGEKETNTIAVKA
FT                   EKLRLFANTSTQSVPSRQPLDETERTSSSFLPWLFGFFIFGFLIVIFTVIVPRMKKFVP
FT                   "
     atgaagggta gaagacgtct tatgatgttc tgtttcccct ttctctgctc tgtattggct        60
     gcgatgggaa tgacggttta cgcggaatcg gatgagtggc cggaaattga accaaatcaa       120
     tatcagcggc aggacatcga attgcgcacc gattatcttc atgaagagtc gctgcttgac       180
     gaaaagagag atttgccaga ggtgcaaaca tcgctgacat ttcaaagacc ggcctcttct       240
     ttctttgagc gaacaaaagc gcagttgttt ttatcgggag aaaaagaaac gaatacgatt       300
     gccgtcaaag cggaaaagct gcgattgttt gctaacactt caacacaatc ggttccgtct       360
     cgccagccat tggatgagac ggaacgaaca tcatcatcat ttctgccatg gctgttcggc       420
     tttttcattt tcggctttct tattgtcatc ttcaccgtca tcgttccgcg catgaagaag       480
     tttgttccgt aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page