(data stored in ACNUC7421 zone)

EMBL: CP002293.PE421

CP002293.PE421       Location/Qualifiers
FT   CDS_pept        479090..479401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0437"
FT                   /product="Retroviral VpR/VpX protein"
FT                   /note="PFAM: Retroviral VpR/VpX protein; KEGG:
FT                   gwc:GWCH70_0293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73277"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIM6"
FT                   /inference="protein motif:PFAM:PF00522"
FT                   /protein_id="ADP73277.1"
FT                   /translation="MASLLESIEKEWKRRAYEAMIHCLQSYQGQVEEAIEEFQHGTRAF
FT                   YRANDEYVPHWQGKSREAYEWVYEDLRQIETRIYATADDLLHEISREIARIRRKIEEL"
     gtggcgtctt tattggaatc gatcgaaaaa gaatggaaac gcagggccta cgaggcgatg        60
     attcattgcc tgcagtccta tcaagggcag gtcgaagaag cgatcgagga atttcaacat       120
     ggcactcgtg cattttatcg cgcaaatgac gagtatgttc cgcattggca ggggaagtct       180
     agggaagcgt atgaatgggt atacgaggac ttgcggcaaa tagagacacg tatttatgcg       240
     actgcagacg atcttcttca tgaaataagc agggaaatcg cgcgaatccg tcgaaagata       300
     gaggagttat aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page