(data stored in ACNUC7421 zone)

EMBL: CP002293.PE423

CP002293.PE423       Location/Qualifiers
FT   CDS_pept        480499..480840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_1605 resolvase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73279"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIM8"
FT                   /inference="similar to AA sequence:KEGG:Cbei_1605"
FT                   /protein_id="ADP73279.1"
FT                   /translation="MEDYIIINLENDDEDEFDLEGKNVAQIKVFNTKGEDITSNCRVIF
FT                   ELSEEALIGLGTELIRLSKRFKDGKHIHLVPSDKQFISQSMGIFLTSKSCEMIIGCTEF
FT                   GKIEDHLDD"
     ttggaagatt atattattat taaccttgaa aatgacgatg aagatgaatt cgacttggaa        60
     ggcaaaaatg tcgcacagat taaagtattt aatactaaag gtgaggacat aacctctaat       120
     tgtagagtga tatttgaatt aagtgaagaa gcattaatag ggcttggaac tgaattaatt       180
     agattatcta agcggtttaa ggatggtaag catattcatc tagttccttc agataaacaa       240
     tttattagtc aatcaatggg aatatttctt acctcaaaaa gttgtgaaat gataataggc       300
     tgtactgagt ttggaaaaat tgaagaccat ttagatgatt ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page